Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "economy"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

3. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

4. It is an important component of the global financial system and economy.

5. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

6. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

7. The momentum of the economy slowed down due to a global recession.

8. The nature of work has evolved over time, with advances in technology and changes in the economy.

9. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

10. The United States is the world's largest economy and a global economic superpower.

11. This has led to a rise in remote work and a shift towards a more flexible, digital economy

Random Sentences

1. Technology has also played a vital role in the field of education

2. Sino ang kasamang kumanta ni Katie?

3. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

4. Que tengas un buen viaje

5. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

6. The surface of the football field can vary, but it is typically made of grass or artificial turf.

7. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

8. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

9. Anong nakakatawa? sabay naming tinanong ni Sara

10. Bumalik siya sa Pilipinas kasama ang suporta ng mga Amerikano noong 1898.

11. Kung walang tiyaga, walang nilaga.

12. Mula pagkabata ay naging magkaibigan na si Lando at Maria.

13. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

14. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

15. Inalok ni Maria ng turon si Clara.

16. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

17. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

18. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

19. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

20. Kailangan nating magtiyaga at magsumikap sa ating mga pangarap, datapapwat ay hindi ito agad-agad natutupad.

21. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

22. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

23. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

24. Claro, haré todo lo posible por resolver el problema.

25. Ang nakakalungkot na balita ay nagdulot ng malalim na naghihinagpis sa buong komunidad.

26. Bata pa lang si Tony nang iwan sya ng kanyang ama

27. Magalang na hiniling niya ang tulong ng guro sa kanyang takdang aralin.

28. Dumaan ka kay Taba mamayang pag-uwi mo, narinig niyang bilin ng ina.

29. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

30. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

31. Ang pagmamalabis sa paggamit ng mga plastik na bag ay nagdudulot ng environmental pollution.

32. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

33. Tengo vómitos. (I'm vomiting.)

34. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

35. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

36. He juggles three balls at once.

37. Has she written the report yet?

38. The company acquired assets worth millions of dollars last year.

39. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

40. Nakita rin kita! ang sabi niyang humihingal

41. Mahal na mahal kita. Ikaw lang. pabulong kong sabi.

42. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

43. Itinago ko ang mga sulat para sa inyo.

44. Det er en vigtig del af vores moderne liv, og det har haft en stor indvirkning på måden, vi lever, arbejder og kommunikerer på

45. She's always gossiping, so take what she says with a grain of salt.

46. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

47. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

48. Kailangan ko gumising nang maaga bukas.

49. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

50. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

Recent Searches

economyyankrussinagotpoliticshigaconventionaltulonglagaslasunconventionalmakasalanangpaglalabananaseanasimbitbitpunong-kahoynaglutorebolusyonprobinsyamaishardinleadantesbulongmaalwanginteracthelenaanyoboholandamingenteralisawitbanalhanginnapagtuunanpaglipasrodriguezkawalanlakassiranaiilangwhichskypeitinakdangartistdahilanlimitnizfuncionarmaaarineabahay-bahaydamitmaarikayodanmarktinulunganmahiwagangngitibaleiniunatnegosyomagdaraoskirbysaadmaghugasletdulobuwayaandrewanitobagayoperativosmamimilipanitikan,slaveilangalakexperts,unahapunanayossakimsarilisarilingkidlatrelydiseasesnakadinanassinapitnakitamang-aawitnaghihinagpismakapangyarihanbasahinpagkapanalotandabonifacioturobituinlugawhojastradesumigawmataposproductiondalinagsalitadiagnosespreviouslydesisyonanapoyopisinapinatidsharedasaltheirmasokkamalayannamingnagisingtransmitsalaypatakasroleinterestbirthdaymatagal-tagalsupporthapag-kainansupilinkitangteknolohiyalasamagnifynagmamaktolibonlayuanpulissambitpnilitbarkomartapagdukwangkalimutangurocedulaahitprusisyonhinanakitjosedatapwatexpertkapatagannanaisinnakasakaypakpakbilaoparusamanuelpakibigaysysteminiisipnaawanumerosaskwebalingidkasalriyanitinuturojohnsimplengbasamusmosdaturubberhabanghospitaluntimelyibanghomeworkumiiyakdinbawatukol-kaypaghakbangkanindumipagmasdannagtutulungansamahankapatidomfattendesapatkundihinogkahoykwenta-kwenta