Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "economy"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

3. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

4. It is an important component of the global financial system and economy.

5. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

6. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

7. The momentum of the economy slowed down due to a global recession.

8. The nature of work has evolved over time, with advances in technology and changes in the economy.

9. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

10. The United States is the world's largest economy and a global economic superpower.

11. This has led to a rise in remote work and a shift towards a more flexible, digital economy

Random Sentences

1. Sa kabila ng pag-iisa, may mga taong handang tumulong sa kaniya.

2. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

3. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

4. The traffic signal turned green, but the car in front of me didn't move.

5. ¿Te gusta el sabor picante del jengibre?

6. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

7. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

8. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

9. Madalas na naglulusak sa dumi ang mga bakuran.

10. At hindi papayag ang pusong ito.

11. Marahil ay hindi mo pa nakikita ang bagong pelikulang ito kaya't dapat mo itong abangan.

12. Hindi malaman kung saan nagsuot.

13. La tos puede ser un síntoma de neumonía.

14. Madaming squatter sa maynila.

15. Tumawa nang malakas si Ogor.

16. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

17. Gracias por entenderme incluso cuando no puedo explicarlo.

18. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

19. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

20. Omelettes are a popular choice for those following a low-carb or high-protein diet.

21. There are a lot of amazing destinations to explore around the world.

22. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

23. Ang apoy sa kalan ay nagbabaga pa rin kahit patay na ang apoy.

24. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

25. Hindi siya puwedeng uminom ng beer.

26. Nagtagisan ng galing ang mga maghahabi.

27. Maraming bayani ang nagawa ng mga bagay na imposible sa panahon ng kanilang panahon.

28. Ang pagpapalaganap ng mga konspirasyon at teorya ng kung ano-ano ay nagpapakita ng pagiging bulag sa katotohanan.

29. Maraming tao ang nagpapanggap na bukas palad upang makuha ang gusto nila, kaya kailangan nating maging maingat.

30. Sobrang mahal ng cellphone ni Joseph.

31. Ah salamat na lang, pero kelangan ko na talagang umuwi.

32. Ano ang gustong sukatin ni Elena?

33. Unti-unting lumapad yung ngiti niya.

34. Da Vinci murió en Francia en el año 1519.

35. Ok ka lang ba?

36. Mahirap magtiis kung mahal mo sya.

37. Si Juan ay napakagaling mag drawing.

38. Mayroon akong asawa at dalawang anak.

39. Traveling to a conflict zone is considered very risky.

40. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

41. Huwag kayo maingay sa library!

42. By the way, when I say 'minsan' it means every minute.

43. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

44. The new restaurant in town is absolutely worth trying.

45. Ang mga bayani ng kasaysayan ay dapat na itinuring at ipinagbunyi bilang mga pambansang tagapagtanggol at inspirasyon.

46. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

47. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

48. Sa palagay ko, pangit ang kotse ng tiyo ko.

49. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

50. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

Recent Searches

economypagsalakaynagkasunognamulatnagtutulakkasangkapaneskwelahanpare-parehopusatumubonakatagopasosnageespadahannagpakunotkumidlattungawpinag-aralanpamilyangnananalokinakabahanmasasabiautomatiskmasyadongre-reviewclassesnakalockaga-agakongresomagpapigilsumpunginlutomorningtumindigbarrerasmagpakaramitsismosapantaloniniresetanakisakaysarisaringsurveysumokaypinansinnatanongmagkanonaiiritangnanonoodculturesinilabasnapakabilispakakasalanduongownhumigahinintaypnilitcommercialhinanaphatinggabivelfungerendemaglabaipinansasahogkendidustpannapagodnapapatinginhabitnapakotsinelasasiatagakdisenyobikolredesmagnifykulotbrasopatiencecareermaliitmaayosnaislaranganngisiinantayparangstruggledlookedniconaggalatinitirhanmartespopulariyanartistskombinationkindspitumpongnatalonginihandanahihilosacrificematigaskatapatnapag-alamanmagpasalamatsquashsalesbarrocobuslofurtaassinkbalancesdaladaladipangamopetsangaseanoutlinessumabogpshmalagolaborsinlamanfueliskobecomeusalordmakipag-barkadamatatalimkuryentemuchaselectionsmarchadverselymaaringpitakatrafficsparkpersonalmasayahydelisugasigningslayout,sulingantargetcontinuespinunitharmfulbubongtekstoutpostoperateintramurosgrabenariningtimenatingnerissaimpitfigureevenplatformsbroadbaldeinteractalakdalasimplengprogressuloevolvedgeneratedlasingbackmenuclassmatenotebookknowmagkasamangpangkaraniwansouthmatutongbulakpaghabautak-biyatiningnanitinulossiyangtulisang-dagatgandanalangconvertidasubotig-bebeintekwebang