Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

24 sentences found for "andre"

1. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

2. Andre helte er kendt for deres humanitære arbejde.

3. Andre helte er stille helte, der arbejder i skyggerne.

4. At have en sund samvittighed kan hjælpe os med at opretholde gode relationer med andre mennesker.

5. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

6. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

7. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

8. At være ærlig over for os selv og andre er vigtigt for en sund samvittighed.

9. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

10. At være transkønnet kan påvirke en persons mentale sundhed og kan føre til depression, angst og andre psykiske udfordringer.

11. Børn bør lære om ansvar og respekt for andre mennesker.

12. Børn har brug for at lære at samarbejde og kommunikere med andre.

13. Børn skal beskyttes mod vold, misbrug og andre former for overgreb.

14. Danmark er kendt for at eksportere højteknologiske produkter og services til andre lande.

15. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

16. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

17. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

18. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

19. Mange steder i Danmark afholdes der påskeoptog og andre offentlige begivenheder i løbet af Holy Week.

20. Maraming bagong laruan sina Justin at Andre.

21. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

22. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

23. Påsken er en tid, hvor mange mennesker giver til velgørende formål og tænker på andre, der har brug for hjælp.

24. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

Random Sentences

1. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

2. Ang pusa ay nasa ilalim ng upuan.

3. They may draft and introduce bills or resolutions to address specific concerns or promote change.

4. Limitations are the boundaries or constraints that restrict what one can or cannot do.

5. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

6. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

7. Nakapila sila sa kantina nang limahan para maging maayos.

8. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

9. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

10. At tuluyang nagliwanag ang buong paligid at nawala ang dalawa.

11. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

12. Maganda ang pakiramdam kapag mayroon kang kaulayaw na makakasama sa buhay.

13. Mathematics is an essential subject for understanding and solving problems in many fields.

14. Magtiis ka dyan sa pinili mong trabaho.

15. Dette er med til at skabe en høj grad af social tryghed for befolkningen, og det er også med til at sikre, at Danmark har en lav arbejdsløshed

16. No hay que perder la paciencia ante las adversidades.

17. What goes around, comes around.

18. Debemos enfrentar la realidad y no ignorarla.

19. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

20. Ang kotseng nasira ay kotse ni Jack.

21. Ayaw ng kaibigan ko ang mainit na panahon.

22. Mathematics can be used to analyze data and make informed decisions.

23. If you keep beating around the bush, we'll never get anywhere.

24. The company suffered from the actions of a culprit who leaked confidential information.

25. Scientific research has shown that regular exercise can improve heart health.

26. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

27. The website's search function is very effective, making it easy to find the information you need.

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

30. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

31. Matapos ang matagal na paghihintay, ang aking pag-aalinlangan ay napawi nang dumating ang inaasam kong pagkakataon.

32. She admires the philanthropy work of the famous billionaire.

33. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

34. Tumugtog si Jemi ng piyano kahapon.

35. Ang mga karapatan ng mga anak-pawis ay kailangan ipagtanggol at ipaglaban.

36. Human activities, such as pollution and deforestation, have a significant impact on the environment.

37. Nagbabaga ang talakayan sa klase habang nagtatalo ang mga mag-aaral tungkol sa isyu.

38. Sweetness can be used to mask other flavors and create a more palatable taste.

39. Marurusing ngunit mapuputi.

40. However, there are also concerns about the impact of the telephone on society

41. Ang saya ng Pinoy fiesta, lalo na kapag may parada at sayawan.

42. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

43. Uuwi si Ellen sa Cebu sa Pasko.

44. Nag-aaral siya sa Seasite bawat araw.

45. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

46. Titira kami sa Banawe sa darating na panahon.

47. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

48. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

49. El realismo y el impresionismo son estilos populares en la pintura.

50. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

Similar Words

AndrewAndreaAndres

Recent Searches

andreawitpakipuntahanpangulolumakasbeganalapaapinalokhydelmagandangdemocracyvaliosainyongkasapirinsetschildrenpag-ibigbinatilyoapologeticitemsmainittumirakasamaanbalangpanindangkumpletonuclearinterestsbulongpaggawamartianremainpinagkiskisaloknagtatanongpaghahabilalamunancomenapakatalinoself-publishing,dreamsnapipilitanharpmaranasancreativesuotpedeeviljackybinabapalapagmasasalubongmakawalatoretekumembut-kembotnaantigbisikletakinuhakilaymagnanakawnag-googleitinindigadvancementdiplomaclockmatakawthirdmatapangkenditiniobibilipinag-usapanopportunityhousepotaenaanoaraw-arawbluespanitikanpinapalokapangyarihangmovieadvertising,hanggangkerbyakapellennagtalunantondoisinumpananamannamungananlalamigmatagal-tagalmarangyangcarriestingpinakamahabanakaka-inmiyerkolespinagmamasdantinagaambagnananaghiligracelastingaroundparehongpesowaiterguardakastilangnahigabalatnilaoskinantabridenagtataemaismarahilbulakorasandangerousartistasfriesgngfranciscopare-parehodistancesleekaniyabarung-barongpakelameromakaraanmahuhusayugathurtigereshortoliviamaghihintaysumasaliwasoboyfriendvidtstraktaumentarspaghettimaingattsuperskillkunwastuffedcakenanghihinamaddidayawwaldoderjerryexpertmagisipnaiwangspeechdedicationshouldsabihingtatlosaringspastyleilingpangilgrabesulingannag-iinombiggestbilibdigitalsabikaninabentahanmasterinterpretingsimplengdesarrollarrepresentativejeromepamilihang-bayanoutpostwhileexamplesutilputingpaghihiraplumindolregularmathforskeltumingalamungkahiconduct