Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "choose"

1. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

2. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

3. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

4. Some couples choose to have a destination wedding in a different country or location.

5. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

6. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

7. The library has a variety of books to choose from, ranging from classics to modern literature.

8. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. Anong pagkain ang inorder mo?

2. Para sa kaniya, mas masarap magbasa kapag nag-iisa.

3. Anong oras gumigising si Katie?

4. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

5. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

6. Bilang paglilinaw, ang presyo ng produkto ay may kasamang buwis, kaya hindi na ito madadagdagan.

7. Aray! nagcurve ball sya sa sakit sa sahig.

8. Gusto ng mga batang maglaro sa parke.

9. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

10. Napakaganda ng mga pasyalan sa bansang Japan.

11. Salamat sa alok pero kumain na ako.

12. Gusto mo ba ng mainit o malamig na kape?

13. Kahit paano'y may alaala pa rin siya sa atin.

14. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

15. When in Rome, do as the Romans do.

16. Ano ang nasa bag ni Cynthia?

17. A lot of laughter and joy filled the room during the family reunion.

18. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

19. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

20. Natawa kami sa inasta ni Sara dahil para siyang bata.

21. Es freut mich, Sie kennenzulernen. - Nice to meet you.

22. Hoy ano ba! Wag kang pakelamero! galit na sabi ni Cross.

23. Einstein's theory of general relativity revolutionized our understanding of gravity and space-time.

24. Si Ana ay marunong mag-dribble ng bola nang mabilis.

25. Biasanya, bayi yang baru lahir akan diperiksa secara rutin oleh dokter atau bidan untuk memastikan kesehatannya.

26. At hanggang ngayon nga ay pinatutunayan pa rin ng mga aso na sila ay tapat sa kanilang mga amo.

27. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

28. Mabuti na lamang at hindi natuloy ang sumpa.

29. Ilan ang tiya mo na nasa Amerika?

30. Bumibili si Consuelo ng T-shirt.

31. A penny saved is a penny earned.

32. Las hierbas deshidratadas se pueden almacenar por más tiempo sin perder su sabor.

33. A couple of minutes were left before the deadline to submit the report.

34. Hindi siya nag-aral para sa pagsusulit, samakatuwid, bumagsak siya.

35. Luluwas ako sa Maynila sa Biyernes.

36. Pinoy pride ang dala ng mga atleta natin sa bawat laban.

37. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

38. Gumawa siya ng eksamen para sa klase.

39. Payapang magpapaikot at iikot.

40. Ano ang gusto mong panghimagas?

41. Drinking enough water is essential for healthy eating.

42. Ang magsasaka ay nagtatanim ng palay sa bukid.

43. Facebook Events feature allows users to create, share, and RSVP to events.

44. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

45. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

46. Trapik kaya naglakad na lang kami.

47.

48. Pasensya na, hindi kita maalala.

49. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

50. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

Recent Searches

dailychooseltolivespuwedewastebecamelalakeestilosmatitigastiniginfluencesupuanfriendmatipunobagalatensyonkutodtasayoutubericoanimoysinunodsenatetakesconsistmesttonightbukodlossmeaningkabosesmerryfar-reachingwaribilugangsalarintransmitidasfonosganacomunicannoblesuotiniinomcomputere,sinimulanmaulitmulighedhigitdagasinipangmabilisbatosamfundsubjectlawsminutomanuscriptvoteswestbossbilisbibilhinmarsocuentanbrucehumanoaalischoiceadditionagafreelancerchadboksingmag-uusapsinochambersvasquespollutionbarheilivefaultfononalasingmuchosadventwalletbinabaanorderaidinilingipagtimplaechaveprovidedelectronicfatalrolledemphasismapapaabsbadclientesitemscuandotopicincludenicehapasinactivitywhyherebeforeipihitnagdadasalkahoykasinggandaearnarbularyodagligeandroiddreamsdumaloinagawnakaririmarimnagbiyayahumalonatuloysumusunosayanilayuanunibersidadhinawakaninaloksasapakinparusahanattorneykirbynakauslingpagbatimabigyannabigaysugatanganumangcaracterizapangingimigraphicmournedkatandaanbiglablusangsipaletternasabingiiklikalakingmustipinauutanglumusobpinangalanannaglutotelebisyontutusintulisantumaposmaglaropabulongnakilalaipinanganakparehasbestidadisenyokendimaghahandamonumentorestawrantulalasapilitangmatesamadalingpagigingpisaraparemagbagong-anyomakalaglag-pantypansinpagpapakalatdistansyakinatatalungkuangnakapangasawamagkikitavirksomheder,nakakapamasyalikinatatakotpinagmamalakisalamangkeronangangahoypinakamatabangmusicianpaglalayag