Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "industry"

1. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

2. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

3. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

4. In this industry, singers who can't write their own songs are a dime a dozen.

5. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

6. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

7. Sweetness is an important factor in the culinary arts and food industry.

8. The job market and employment opportunities vary by industry and location.

9. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

10. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

11. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

12. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

Random Sentences

1. She does not skip her exercise routine.

2. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

3. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

4. Les travailleurs doivent respecter les heures de travail et les échéances.

5. Masakit ang ulo ng pasyente.

6. A lot of traffic on the highway delayed our trip.

7. They have seen the Northern Lights.

8. Pakibigay sa akin ang listahan ng mga paalala bago ako maglakbay.

9. Danmark eksporterer mange forskellige varer til lande over hele verden.

10. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

11. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

12. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

13. La tos nocturna puede ser un síntoma de enfermedades respiratorias como el asma y la apnea del sueño.

14. Marahil ay hindi niya naaalala ang pangalan mo kaya't dapat mo siyang i-pakilala.

15. Sa katagalan, natanggap na niya ang panunuksong ito.

16. Binigyang diin niya ang pagpapasakit ng Anak ng Diyos.

17. Palibhasa ay may kritikal na pag-iisip at kaya niyang magbigay ng mga valuable opinions.

18. Sa gitna ng pagkabigo, hindi maiwasan ang paglabas ng malalim na himutok.

19. Ang droga ay isang mapanganib na sangkap na maaaring magdulot ng malubhang mga epekto sa kalusugan ng isang tao.

20. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

21. In this industry, singers who can't write their own songs are a dime a dozen.

22. Sweetness can be used to mask other flavors and create a more palatable taste.

23. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

24. Ahhh...wala! Bakit ba, nagdadasal ako noh!

25. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

26. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

27. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

28. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

29. The bride looked stunning in her wedding dress, truly a beautiful lady.

30. Ang pagpapalitan ng mga bulaklak ay karaniwang ginagawa sa kasal.

31. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

32. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

33. Nasarapan ako sa luto ni Chef Josh.

34. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

35. Emphasis can be used to create a memorable and impactful message.

36. Nagbakasyon kami sa tabi ng karagatan noong tag-init.

37. Hindi na napigilan ni Anna ang kanyang hinagpis nang marinig ang masamang balita.

38. Ibinigay ko ang aking buong atensyon sa kanyang mga salita upang maunawaan ang kanyang mga kahilingan.

39. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

40. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

41. Mas matangkad ako kaysa sa kanya.

42. He tried to keep it a secret, but eventually he spilled the beans.

43. Alas-diyes kinse na ng umaga.

44. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

45. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

46. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

47. Women have shown remarkable resilience and strength in the face of adversity and oppression.

48. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

49. Ang pagkakaroon ng mga programa at kampanya sa paglaban sa droga ay mahalaga upang maiwasan ang pagkalat nito sa lipunan.

50. Mencapai tujuan dan meraih kesuksesan dapat memberikan perasaan kebahagiaan yang mendalam.

Recent Searches

industryaudiencebilivehiclesmaismerrykumaripasginangrosacigarettepookproducirtinutopresponsiblepdaauthornakakitatreatssiniyasatkatawanghumalakhakpagbigyannagagamitnag-aagawannabubuhaymasaktanvidtstraktnatabunantinahakpapayapakibigyantelebisyongawaingkailandumilatbasketballpesonakapagproposehinanapanihinparurusahankasalanansumingitbarabasnizamericanparehasmachinestulalaganakinseokaywidelydiyospolospecialrailwaysbranchreplaceddaangactingmapuputitanimmuchasplatformsemphasisidea:sulinganochandovisualtechnologiesrepresentedviewsyonnagkitamagasawangkahaponrevolutioneretpaghihingalodadalawinmagpagalingmananakawnaguguluhankatuwaanmauliniganmakikitulogpagamutanuulaminmangahasnapatigilkamandagkumampiumagawmaghapontabingeleksyontatlopagmasdanpigingginaganoonkaugnayantibigbigyannag-replymarumidibailocossanhangaringzooiiklilalabhanmabalikhighfuncionesmodernpollutionbroadcastsgitnadarksquatterpakitimplajoysagingmentalsinaliksikmakenangagsipagkantahannaglipanangnaglalarokagalakansasagutinhellokondisyonkisstaglagasperyahankabiyaknakangisinggovernorssusunodpag-aaniwantmarangalpaglayasnakabiladpagpasokpa-dayagonalsalatinpaggawatresmalapitanroselleginawangloanslatedayspedenginteligentessetsrepresentativecountlessworkcleanawang-awaumiinompaki-drawingmahuhusaypangungutyakinikitamanahimikmahinapaghanganalagutanngayoniiwasanumiibigpaanonatutuwabalikattmicapinatawadpnilitiyonghinampasbutitomorrowsadyangkasocapacidadcarriesaaisshfiabeganopomahahabahanbobosaringeto