Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "industry"

1. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

2. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

3. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

4. In this industry, singers who can't write their own songs are a dime a dozen.

5. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

6. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

7. Sweetness is an important factor in the culinary arts and food industry.

8. The job market and employment opportunities vary by industry and location.

9. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

10. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

11. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

12. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

Random Sentences

1. Nagsisilbi siya bilang abogado upang itaguyod ang katarungan sa kanyang kliyente.

2. Ilang kutsaritang asukal ang gusto mo?

3. Hindi tayo sigurado/nakatitiyak.

4. Napansin ko ang bagong sapatos ni Maria.

5. Ang mabangong lotion ay nagbibigay ng pag-aalaga sa balat at magandang amoy.

6. Habang tumatakbo siya, tila lalong palayo ang kanyang mga pangarap.

7. Tuwang tuwa siya sa mga palaka, para sa kanya ay nakakaakit ang mga malalaki at bilugang mata ng mga ito.

8. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

9. Hindi ko alam kung paano ko sasabihin, pero crush kita.

10. Mahalaga ang pagkakaroon ng kalayaan sa edukasyon upang mapalawak ang ating kaalaman at pag-iisip.

11. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

12. Effective use of emphasis can enhance the power and impact of communication.

13. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

14. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

15. The level of sweetness can vary in different types of sugar and sweeteners.

16. Where there's smoke, there's fire.

17. The guilty verdict was handed down to the culprit in the embezzlement trial.

18. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

19. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

20. Naman! Alam niyo yung feeling na alam kong siya na talaga?

21. Musk has been involved in various controversies over his comments on social and political issues.

22. The host introduced us to his wife, a beautiful lady with a charming personality.

23. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

26. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

27. Kaya't pinabayaan na lang niya ang kanyang anak.

28. Einstein's legacy continues to inspire scientists and thinkers around the world.

29. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

30. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

31. The credit union provides better interest rates compared to traditional banks.

32. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

33. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

34. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

35. Eine klare Gewissensentscheidung kann uns helfen, uns selbst treu zu bleiben.

36. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

37. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

38. The sports center offers a variety of activities, from swimming to tennis.

39. Maya-maya lang, nagreply agad siya.

40. Hello love birds! bati ko sa kanila nang makalapit ako.

41. Format your book: Once your book is finalized, it's time to format it for publication

42. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

43. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

44. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

45. Limitations can be a result of fear or lack of confidence.

46. Kanina pa kami nagsisihan dito.

47. Sasagot na sana ako ng 'oo' ng...

48. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

49. Nagngingit-ngit ang bata.

50. Los powerbanks son una solución práctica y conveniente para mantener los dispositivos electrónicos cargados cuando se está fuera de casa.

Recent Searches

1950sindustryaffiliatenapakasaidrosaasulhumanoperlakamatisnatingalaguestsrailiiwanvisbilistipidpapuntangdiferentesindustriyainloveproducererbalikate-booksregulering,cultureskainitangumigisingnagsilapitasiaticiyaktigasarkiladesarrollartsuperangalenglandmaatimsmilemaisipmonumentonagliliwanagginugunitamagtatagalnagtitindakumukuhalugarginookinatitirikanmag-plantnatatawaiyanbinigaylumiwagkapangyarihanpakanta-kantangkalakihanpagkakamalihila-agawantobaccopagtatapospagpasensyahanmakikipag-duetopinakamatabanghalinglingundeniablefollowingandreabinabaratasahannagwikangadvancementna-curiouspinabulaanpagmasdanrevolutioneretnawawalanangangaralgagawinpresence,tatayokuwartomonsignoraanhinfollowing,tinangkana-fundnaulinigannapapansinmauliniganpinapataposnapapahintonahintakutannangahasairportpagkasabimagkakarooni-rechargematadiyaryomagkanotinataluntonpatakbotumatakbobalediktoryannanunuksopagsubokmakapagempakebowlpinigilantennisnakasuot11pmbeginningsmasseslingidpriestmaulitgoalblusasentencebasahinindiawikamerchandiseanumanmisteryokasimagdilimlabahinnapasukoabutanmaibabalikpresencesumasakayduwendemeremuchelectedrequireilingjunjuncreationqualitycommunicatethreewhygamotcongressdilimboksingsobrasusunduinisaacsilbingrepublicpinatidmariomanuscriptdiretsoilocosmalumbayboholginaganoonlumilingonpaskongpongkontingtelefontoymagbigayanpagputimetodedarkhimigdigitalipagtimplacontinuesbadfuncioneselleneyebornipasokshockinisbinabaanmapakaliinalissteveespadaexperienceslackprospercoaching:ofreceneleksyonklasengmayroonwidespread