Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "robotic"

1. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

Random Sentences

1. Nationalism can also lead to xenophobia and prejudice against other nations and cultures.

2. Yan ang totoo.

3. Higupin ng araw ang tubig-ulan sa kalsada.

4. Dahil sa mga kakulangan at risk na nakikita ko, hindi ako pumapayag sa kanilang plano kaya ako ay tumututol.

5. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

6. Una de mis pasatiempos más antiguos es coleccionar monedas y billetes de diferentes países.

7. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

8. La película produjo una gran taquilla gracias a su reparto estelar.

9. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

10. Congress, is responsible for making laws

11. Ang kamatis ay mayaman din sa vitamin C.

12. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

13. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

14. I have a craving for a piece of cake with a cup of coffee.

15. Handa na bang gumala.

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

18. Les personnes âgées peuvent continuer à poursuivre des activités et des hobbies qu'elles aiment.

19. Give someone the cold shoulder

20. Mathematics helps develop critical thinking and problem-solving skills.

21. Busy pa ako sa pag-aaral.

22. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

23. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

24. Mag o-online ako mamayang gabi.

25.

26. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

27. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

28. Ano pa ba ang ibinubulong mo?

29. Ang pagsama sa kalikasan ay nagdudulot ng isang matiwasay na kalooban.

30. In der Kürze liegt die Würze.

31. Okay.. sige.. intyain ko na lang tawag niya.. thanks..

32. Det er vigtigt at huske heltenes bedrifter og lære af dem.

33. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

34. Les travailleurs peuvent travailler à temps plein ou à temps partiel.

35. Working can provide a sense of purpose, achievement, and fulfillment.

36. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

37. Ang bagal ng sistema ng pagbabayad ng buwis.

38. Nagliliyab ang mga damo sa bukid dahil sa sobrang init ng panahon.

39. Los efectos a largo plazo del uso de drogas pueden ser irreversibles.

40. The judicial branch, represented by the US

41. Mabuti pa sila, nakikita ang masayang paligid.

42. Ang pagpapahalaga at pag-unawa ng aking mga magulang sa aking sitwasyon ay nagpawi ng aking lungkot at kalungkutan.

43. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

44. Binabasa niya ng pahapyaw ng kabuuan ng seleksyon at nilalaktawan ang hindi kawili-wili

45. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

46. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

47. Sa ganang iyo, mahalaga ba talaga ang pagkakaroon ng mataas na grado sa eskwelahan?

48. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

49. Sweet foods are often associated with desserts, such as cakes and pastries.

50. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

Similar Words

robotics

Recent Searches

pakelambillroboticinfluencethreepapuntayamansulyapbaku-bakongmagkahawakkaaya-ayangtinitignanpagtatanongmanualnakapagsabikagandahanbilanggorebopahahanapmahiwaganasasabihanmatatawagnasagutankulunganpamagatpapalapitculturesanumangbook,prinsesangpromiseipagmalaakivegasipinamilililymassachusettskutsilyoiguhitkainbusylimosstarwalisundeniablecontentuncheckedpowersmarumingespecializadassabadongpaglalaitcultivacameranagkasunogpaglalabadatitao-onlinengumingisimasyadongmagpakaramiano-anotiyakanninumanmagbasanagpapaitimconstantnyanlinanatayohinigitnunoeducationresorttinanggapattentionharingyelocanadapinilingsmallpinangyarihanmovinginantaytissuenapaagaalesdi-kawasadisenyonginferiorestaracancermahinogbinentahannaghihirapmasayahawlariquezakatolikopamamahingakabuhayanlimitedgagatinbagyousaelectionsisaacsinongeffectseitherjeetzoonanonoodmarketplacesnakalilipasinirapanaplicacionesstarsnangangakovideosestasyonsuriinsinimulansayawanipinambilimay-arihoyabanganmatapossubalitdayanitobosesdecisionsstoreshouldactorstringnami-misspunung-kahoydedicationdagatpagtuturomaramingpinag-usapangayundinikinamataymoviesmasaganangisulatnakadapanageespadahanexhaustionamericakaninogospelnawalamakaiponmantikapootnagkakasayahanmasipagejecutansalesbaroflaviokalakingmisaitakorderinbakespeedinvolvereturnedstatebaboykeepitoclimbednakikini-kinitapare-parehokinagagalakikinalulungkotdagat-dagatannamumutlatravelermananaogsumusulatkabiyakregulering,tinuturoexigentenaghuhukaymaasimmensninananoodsalatinreviewlazada