Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

2. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

3. Nag tinda kahapon ang aking ina upang kami ay may makain ngayong araw.

4. Sumakay pa rin sila ng bangka at umalis kasabay ng agos ng ilog.

5. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

6. Sa sobrang dami ng mga dapat gawin, may mga pagkakataon na naglilimot siya sa ilang mga mahahalagang mga takdang-aralin.

7. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

8. Two heads are better than one.

9. You're not being direct. Stop beating around the bush and just say it.

10. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

11. Nakaka-bwisit talaga ang nangyari kanina.

12. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

13. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

14. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

15. Actions speak louder than words.

16. Nasa kuwarto po siya. Sino po sila?

17. Naghanda sila para sa kasal na gagawin sa bundok.

18. Nakita ko ang kanyang halinghing na unti-unti nang bumibilis dahil sa takot.

19. Pahiram ng iyong cellphone, nawala ang aking battery.

20. Promise yan ha? naramdaman ko yung pag tango niya

21. Sa paligsahan, pumasok sa entablado ang mga kalahok nang limahan.

22. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

23. Emphasis is an important component of artistic expression, such as in poetry and music.

24. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

25. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

26. Talaga? Ano ang ginawa mo sa Boracay?

27. The actress on the red carpet was a beautiful lady in a stunning gown.

28. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

29. Ang pagkakaroon ng karamay at suporta mula sa mga mahal sa buhay ay makatutulong upang malunasan ang pangamba.

30. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

31. Ang hina ng signal ng wifi.

32. Ang buhawi ay isang malakas at mapaminsalang bagyo na karaniwang nagdudulot ng malakas na hangin, pag-ulan, at pagbaha.

33. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

34. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

35. Madami ang nawalan ng trabaho dahil sa pandemya.

36. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

37. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

38. Nagpunta ako sa theme park kasama ang mga kaibigan ko kaya masayang-masaya ako ngayon.

39. Magbibiyahe ako sa Mindanao sa isang taon.

40. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

41. Esta salsa es muy picante, ten cuidado.

42. Oo. Pero kelangan.. susunod ka lang sa akin, ok ba yun?

43. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

44. Emphasis is the act of placing greater importance or focus on something.

45. Technology has also had a significant impact on the way we work

46. Kailangan mong umintindi ng kaibuturan ng kanyang pagkatao upang magkaroon kayo ng mas malalim na ugnayan.

47. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

48. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

49. Kailangan ng sapat na pagpaplano upang maipon ang sapat na pera upang mabayaran ang utang sa tamang panahon.

50. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

Recent Searches

dietnasabingmahahababotokotsengalaalatapearguelargercompostelaplacecardilogtuwangbabesiguhitsinapakcallerpingganguardamatchinglatestwidecriticsbasahanerapluisconventionalpasanjameslulusogfatbuwalchadbugtongsinisirainternetclearobstacles4thsumapitposterspaghettihariinuminunopackagingelectedskillreleasedformjohnpeterapollocleancandidatekapilingsequeexampleberkeleyaffectstyrerinfinitygapmanagerkagatolmartianincluirmisteryoipipilitayonlabananinompinilibumugadurantejuanitonagandahanmandirigmangmatapobrengkalayuanmag-isatendernaglokohannakapikitapoylendingmeaningtakeskindskasabaynagbungaagaioslibreappnapakasinungalingpagluluksanapakatalinonagmamadalinakapaligidpintohinawakannakikini-kinitanakaliliyonggayunpamankahoykasaganaantinatawagfloornakalilipasnagbiyayanalalabidyiphumiwalaypamumunoinsektongitsuradahan-dahanbestfriendnaglakadsiniyasatnakaririmarimedukasyonkamiassumunodnaglarolumayomawawaladangerouslarawantrafficfistsapelyidoe-bookspaparusahantinataluntonmakapaltennisgumuhitinagawdatapuwanegosyantepapalapitpatakbongvictoriacruzsamantalanghagdananbangkangmagawamatutongnuevosumulanpadalasnabigaymbricospantalongvaliosanamamayatnilayuanwantnatutuwadyosahihigitpakibigaysocietyipinambilipakealamandustpankabarkadaalmacenarminamasdanmalasutlalinamauntoglayuankasalanantrajemarangyangmayamangbagkuspinatirabilanginhoyibinalitangmedyomataposvetowidelyinangcapacidadleadingdogslaroaumentarlumulusobosakatagalogmalaki