Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang panitikan ay may kakayahan na magbukas ng ating isipan sa iba't ibang kaisipan at ideya.

2. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

3. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

4. Emphasis can help clarify and reinforce the meaning of a message.

5. Umulan man o umaraw, darating ako.

6. Tanging ina lang at kapatid niya ang kanyang kasama

7. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

8. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

9. Ang sigaw ng matandang babae.

10. Kung siya ay salamangkero, bakit hindi niya ginamit ang kapangyahiran niya sa akin?

11. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

12. Mataman niyang inisip kung may iba pang nakakita sa nangyari.

13. Erfaring har lært mig at tage ansvar og være proaktiv.

14. She is cooking dinner for us.

15. Ano ho ang gusto niyang orderin?

16. I'm on a diet, but I couldn't resist having a small slice of cake.

17. El curry tiene un sabor picante y aromático que me encanta.

18. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

19. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

20. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

21. Me siento cansado/a. (I feel tired.)

22. Today, Amazon is one of the world's largest online retailers.

23. Hindi iniinda ng magkakapatid na Lala, Dada at Sasa ang nakapapasong init ng araw sapagkat ito ay nagpapakinis pa nga ng kanilang kutis.

24. Nagbenta ng karne si Mang Jose kay Katie.

25. Sa mga paaralan, kadalasang nagkakaroon ng mga proyektong pagtatanim ng mga punong-kahoy upang maituro sa mga mag-aaral ang kahalagahan ng kalikasan.

26. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

27. She has finished reading the book.

28. Ang lilim ng kanyang payong ay nagsilbing proteksyon sa kanya mula sa matindi at biglang pag-ulan.

29. Kelangan ba talaga naming sumali?

30. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

31. Ate Annika! Gusto ko yung toy! Gusto ko yung toy!

32.

33. At være transkønnet kan være en udfordrende, men også en berigende oplevelse, da det kan hjælpe en person med at forstå sig selv og verden på en dybere måde.

34. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

35. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

36. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

37. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

38. Tignan nyo. ngumingisi! May balak yan! Psh.

39. Sa hatinggabi, maraming establisimyento ang nagsasarado na.

40. Money is a medium of exchange used to buy and sell goods and services.

41. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

42. Naantig ang maawaing damdamin ng mahal na Ada.

43. It's raining cats and dogs

44. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

45. It has been found that by abstaining from smoking a person may be cured of many diseases

46. La paciencia es necesaria para alcanzar nuestros sueños.

47. Samantalang ang ina naman, si Magda, siyang nag-aasikaso sa kanilang bahay at dalawang anak na sna Maria at Jose

48. Nakapagsasakay ang dyipni ng 16 na pasahero.

49. Mahilig kang magbasa? Kung gayon, baka magustuhan mo ang bagong librong ito.

50. Selamat ulang tahun! - Happy birthday!

Recent Searches

diettinahakmakikinighinilapinapataposnakasahodinsektongabundantekusinerokanayanglumiwagnasiyahanhumiwalaynagmamadaliseguridaddaysinfusioneslaylaynagre-reviewnaglalaropapalapitpondokaniyamahiwagakabibisumasambaminamasdangrammarsteerbahay-bahaynagtatrabahoclientefurpopulationbeautyleosinasabikangitanlalamangahaspasanhalippangitnagpakunotlagunapaghalakhakginagawamahinahongpagtinginnakaupotalagaganakailanlaruankinausapsisikattiyakadditionconditionnapapatinginiyontulonghaveamericapatungomahabangbibilhinotraspagkaawamonumentohalamannasuklampaparusahansinunodrobertpaki-translatenakasakittilgangmallsmagpaniwaladumaramireturnedclientsrequirepropesorindiapinakamatabangnakikini-kinitabighaninaulinigankusinakesohagdananlosssurgerynagtalunanproducts:nakilalamatamanabutannaguguluhangnag-booktagakdiscipliner,kamandagrenacentistainilistamagbantaybumabahawaysamohulunapakasipagengkantadanandiyankaybilispamagatpunung-punoalaymonsignorikinabubuhaydyannoongalbularyopersistent,availablecompostelai-rechargeclassmateosakaipagtimplahagdanbarung-barongsumakaydistanciagitnapitonanghingibumalinghehestruggledrebolusyonpleasematitigasyeyantoniolagnatmangingibigkakaantaylibongpapuntapagsagotafternoonvidenskabensoccermilagasolinaklaseconclusion,katutuboleyteactinghappynatatanawkabangisandisyembremagdamagandi-kawasamagdabinawiannangyayariinuulcerdownkasakitmahawaanhubad1982nakitulogpagkainissinipangnanahimiksakristanstudentspangulohanapbuhaynapagodpunongkahoykatagalanexpertisenamatayvednagmakaawanapakahusaywithoutallottedbloggers,andy11pmadventsabihin