Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Nabagalan ako sa simula ng pelikula.

2. Les scientifiques travaillent ensemble pour résoudre des problèmes complexes.

3. Work can also have a social aspect, providing opportunities to meet new people and make connections.

4. Magandang umaga po. ani Maico.

5. Ano ho ang gusto ninyong orderin?

6. I am absolutely confident in my ability to succeed.

7. May mga punong-kahoy na pinaniniwalaang matatanda nang bago pa dumating ang mga kolonizador.

8. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

9. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

10. Sí, claro, puedo confirmar tu reserva.

11. Hindi na maawat ang panaghoy ng matanda nang makita ang nasirang bahay.

12. Sa kalagitnaan ng pagbabasa, nagitla ako nang biglang mag-flash ang ilaw sa kuwarto.

13. La realidad es que todos cometemos errores, pero debemos aprender de ellos.

14. Akin na cellphone mo. paguutos nya.

15. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

16. The credit card statement showed unauthorized charges, so I reported it to the bank.

17. Anong kailangan mo? pabalang kong tanong.

18. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

19. Chumochos ka! Iba na pag inlove nageenglish na!

20. Nagsusulat ako ng mga kwento at mga katha upang palawakin ang aking imahinasyon.

21. Pangarap ko ang makasakay sa eroplano.

22. The cake you made was absolutely delicious.

23. Eine Inflation von 2-3% pro Jahr wird oft als normal angesehen.

24. Sa sinabi nyang yun napalingon ako ng hindi oras, Ha?!

25. They admired the beautiful sunset from the beach.

26. Busy yung dalawa. Si Aya nandito. sagot ni Lana.

27. Nakakalasing pala ang wine pag napasobra.

28. Anong oras sila umalis sa Camp Crame?

29. I have been swimming for an hour.

30. Wag mo ng pag-isipan, dapat pumunta ko.

31. Maramot siya sa pagkain kaya hindi niya binibigyan ang kanyang mga kapatid.

32. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

33. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

34. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

35. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

36. Nagpuyos sa galit ang ama.

37. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

38. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

39. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

40. Agad na kinuha ni Mang Kandoy ang kanyang itak at tinaga ang mangkukulam.

41. Malapit na ang halalan kaya't nagsulputan na naman ang mga samu't saring pagbati ng mga pulitiko.

42. Bumili ka ng blusa sa Liberty Mall.

43. Hay una gran cantidad de recursos educativos disponibles en línea.

44. Give someone the cold shoulder

45. Hindi dapat puro kababawan lang ang pinaguusapan ng mga tao, kailangan din ng mga seryosong usapan.

46. Nagsimula ang programa sa dakong huli ng gabi.

47. Bwisit talaga ang taong yun.

48. Las hierbas aromáticas agregan un delicioso sabor a las comidas.

49. Siya ay apatnapu't limang taong gulang at nakapangasawa sa isa sa mga magaling tumugtog ng piyano

50. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

Recent Searches

dietmininimizebingolinggolegislationosakaubonicodogsnakaraangmaramibumahaerapstillitonglayaslossabrilmaestrofurniyakapkamag-anakaddingadventnilutoeasierfonoitinaliforcespooksorryspendingavailablelayout,mapapainterpretingmapadalihelpfultakesutilmulti-billionpinunitstudentnariningbroadcastingseparationtheminteriorconnectionresourcespotentialinternetbaldestrengthkayonapakalakingguidememorycurrentcommissionflasheditclientegapmasterviewreallykakuwentuhandi-kawasatupelomoviesdinanasnavigationotrasnamumulotdahilpagkaraaregulering,sections,stuffedrodonapinipilitfreedomskinagalitanhumayogymsurelaganapkapalnakabulagtangarkilaimbessilyamisaumiilingnakapuntatambayanmanagerlcdtermeveningnanghahapdinapaplastikanagwadornagkakakainkinagagalaknagulatginugunitamakikipag-duetonagsisigawaanhinpaghalakhakkagalakannagtrabahonagkakasya1982nagliwanagmakidalotinangkamahiwagangapatnapumaipapautangmaisusuotnapilipandidiriiwinasiwasbiyernespalayolakadgroceryhanapinmbricoslandassayalaranganmarahasinnovationmalilimutanapologeticmaayosmatsingmedicaltrajelalongdingginlihimsamakatuwidbaryogearyoutubebecomenagisingmeaningbarrocotradenaggalapakelambosslayuninabaladalawpdaibabadevicesnizsueloahasutakshapingmakesinternalkayang-kayanghitsurapagkakakawitbroadlightseachtumawamagsugalmarahilprimerostotoongnakikitangnamataymalayosagasaanbaranggaytumalonbahagihawaiitahananerlindaumibigkontratanatutuwawantmahigitpakinabangansikatnuevo