Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

2. Ailments can be managed through self-care practices, such as meditation or physical therapy.

3. Ang pag-aaral ng tao ay hindi lamang sa labas kundi pati sa kaibuturan ng kanyang pagkatao.

4. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

5. Gusto ko sanang bumili ng bahay.

6. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

7. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

8. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

9. Ailments are physical or mental health conditions that cause discomfort or illness.

10. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

11. He is painting a picture.

12. Sino ang nakasuot ng asul na polo?

13. Football is known for its intense rivalries and passionate fan culture.

14. Bwisit talaga ang taong yun.

15. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

16. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

17. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

18. At tuluyang nagliwanag ang buong paligid at nawala ang dalawa.

19. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

20. Hindi sapat ang maging bukas palad lamang sa panahon ng kapakanan, dapat bukas palad ka rin sa panahon ng kahirapan.

21. Paborito nyang panoorin ang Baby shark sa youtube.

22. Lumungkot bigla yung mukha niya.

23. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

24. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

25. Inihayag ng mga empleyado ang kanilang mga mungkahi upang mapabuti ang mga proseso sa opisina.

26. Malalapad ang mga dahon ng halaman na ito at walng mga sanga.

27. Limitations can be a result of geographic location or access to resources and opportunities.

28. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

29. Kasama ho ba ang koryente at tubig?

30. Isang magdadapit-hapon, habang nagpapasasa si Kablan sa marangyang hapunan, isang uugud-ugod na matanda ang kumatok sa kanyang bahay.

31. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

32. Maputla ang kulay ng kanyang mukha ay aywan ba niya at pati siya ay tila pinanawan ng lakas.

33. Baka puwedeng hiramin ko ang iyong mga gamit pang-kemikal para sa eksperimento.

34. Hindi ba nagdaramdam ang nanay at tatay mo?

35. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

36. Nakatayo ang aking guro sa harapan ng silid-aralan upang ipakita ang kanyang mga visual aids.

37. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

38. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

39. Walang konsyerto sa plasa mamayang gabi.

40. The acquired assets were key to the company's diversification strategy.

41. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

42. Tila bakal na kumakapit ang mga kamay.

43. Ang bakuna ay lubos na nakakatulong kontra sakit.

44. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

45. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

46. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

47. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

48. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

49. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

50. Einstein was a refugee from Nazi Germany and became a U.S. citizen in 1940.

Recent Searches

dietnananaghiliaeroplanes-alllilyaustraliacitizenspirasotanghalimakatulogmanoodtilapangetmag-aralhalikannagbababausingnagdaanloveipatuloyaskbigyannapaagaanghelmawalamagpakasalpaghihirapsumimangotleadingconpangyayariconsiderariyomaluwagkatamtamankamalayannabigaymatagalkumidlathomehugispaulit-ulitkongresodemsalamangkerolangostatryghedkalawangingbiyayangmaipagpatuloyalakreturnedpagbatiderestinginmatatagmatabanginventedipinaalammananahisalatjacknaghuhukaytumangobayaninggubatpapagalitanbugtongpinapakainpangkatawitanulikaninokainitanleesiyamnalakinag-iisanananaginipkainanpamilihang-bayankaragatan,alokmanageramabecomemanipissunugingumulongpwedekindleilanpalasabinagpa-photocopytaong-bayanmassespandemyakahaponmagandapakikipagtagpomangiyamotayawfathertinanongaccedernaalisnag-aaralperohinamakgetskabekomunikasyonnagliliwanagaplicakaypawislegacyherramientasenhederpagkainosakasumuotbinilhanmaiskinasisindakanilalagaykundibarrocokababayanpagguhitbagkus,sumapitnakamitjoshtargetnapakahusaynagbiyahecomputersiyentosloob-loobtaksipaglipaskirotresearch:nanggagamotyelotrabahowouldpulitikopagpanhiksamamaintainpistasadyang,natigilanmaramiinaasahanbiyernesdispositivotaonnakitageneratedpagkataposespadakumainpinagkakaabalahanbiglaanmagworkpneumoniasellpakikipaglabanmasasakitumayosreahlagicommercialtuluy-tuloyiyankapintasanglangkayincludingkagatolhospitalsamakatwidanubayansorpresamagtrabahokailanprotegidokasiganoonibinigaywowapelyidosentencenakukulilimaingaykaninainstrumental