Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. May bago ka na namang cellphone.

2. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

3. Hoy ano ba! Wag kang pakelamero! galit na sabi ni Cross.

4. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

5. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

6. Ignorieren wir unser Gewissen, kann dies zu einem Verlust unseres moralischen Kompasses führen.

7. Las labradoras son perros muy curiosos y siempre están explorando su entorno.

8. Sa tuwa ng Elepante ay kumembut-kembot ito sa pag-indak.

9. Ang taong hindi marunong lumingon sa pinanggalingan, ay hindi makakarating sa paroroonan.

10. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

11. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

12. Les salaires varient considérablement en fonction des métiers et des secteurs d'activité.

13. Ang mga kabayanihan ng mga sundalo at pulis ay kailangan ituring at kilalanin bilang mga halimbawa ng tapang at dedikasyon.

14. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

15. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

16. He forgot his wallet at home and therefore couldn't buy lunch.

17. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

18. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

19. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

20. Spil kan have regler og begrænsninger for at beskytte spillerne og forhindre snyd.

21. She has a poor credit history due to late payments and defaults on loans.

22. Tengo dolor de articulaciones. (I have joint pain.)

23. The website's contact page has a form that users can fill out to get in touch with the team.

24. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

25. Oo nga noh? Pero di bale, advance gift ng ninong. aniya.

26. Nang makita ang paparating na ulan, kumaripas ng uwi ang mga bata mula sa palaruan.

27. Ano ang gusto mo, sinigang o adobo?

28. Ang mga punong kahoy ay nagbibigay ng magandang lilim sa takip-silim.

29. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

30. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

31. The wedding photographer captures important moments and memories from the wedding day.

32. The United States has a system of federalism, where power is divided between the national government and the individual states

33. Mabuti pang umiwas.

34. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

35. Ito na yata ang pinakamatabang babae na nakilala niya.

36. Bigla ang pagbabago ng anyo ni Magda at Damaso.

37. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

38. Ang mga botanista ay nagtatanim ng mga endemikong halaman sa mga pook kagubatan.

39. Agad na kinuha ni Mang Kandoy ang kanyang itak at tinaga ang mangkukulam.

40. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

41. Uwi na tayo.. Ayoko na dito sa ospital..

42. Anong oras sila umalis sa Camp Crame?

43. Mayroon nang natanggap na impormasyon ang pulisya tungkol sa pagkakakilanlan ng salarin.

44. Limitations can be a result of geographic location or access to resources and opportunities.

45. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

46. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

47. The stock market is a platform for buying and selling shares of publicly traded companies.

48. Dahil dito ang mga tao ay laging may mga piging.

49. Ngunit marumi sila sa kanilang kapaligiran.

50. Sumakay sa jeep ang mga pasahero nang limahan.

Recent Searches

orderindietbaoipinabaliksinabiaalisdemocratictryghedbienwidespreadhydelnaturaltondagacardmulighedspeechesnakasusulasokdahilkaybiliscapitalistkarnabalbumabastrengthharmfulimpactfistssumaladiniactingbrucemamiitinaliapoyinvolvepowersinterioraccessonlysofauminomnerissadosfiguredarkviewselectronicnaglalababehaviorulingpublishedcompleteevolvegapreturnedtechnologicalcallingviewfrogtoolmenunakakapasokcapitaliskedyulmaligayadataniyacuriouspagpasensyahanbarsobrainiresetabukaskuwartohahahatumatawadhanap-buhayginagawaipinansasahogmagbigayanenglandpagkatbook11pmawabaliwhellorelativelymasaganangpagbabantaahhtargetdalawaginugunitareserbasyontiranteestablishkayaaanhinnakatalungkopronountatagalnakasakitsaangmasinuulcersabihinunidoskolehiyoumuwibayadhinalungkatgrocerynaawapangalanantokyobagkus,makawalataglagasinulitayudadinalasumapitstudentsnagtuturonakakasamanaka-smirkpagkamanghanakitamalezakasaganaanmonetizingdividesbitawanofteexpectationskasinggandashapingsurgeryhighesttopiccableipinalutosambitslaveanotherlarongnagtitiisnaglalatangpagsasalitamaipantawid-gutomkumalmakasalukuyangmakukulaykasintahanmahiwagana-suwaynagtalagacarsmasdannakapasokpakilagayitinuringnagtataasbalitalabing-siyamnakaririmarimgulatatagilirankulunganwatawatkuryentekisstotoonghoneymoonhuluinagawpamagatre-reviewpinangalanangkaklaseabut-abotlavpalamutiuniversitynakilalainterests,miyerkulesmadungishulihanpalayokdireksyonininomlumipadnilaosjosiemaghilamosbundokkampeonhagdanan