Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

2. Lasingero ang tawag sa taong laging nag-iinom ng alak.

3. Eh? Anlabo? Hindi mo naman kaboses yun eh.

4. Nakakamangha ang mga tanawin sa isla.

5. Parang ganun na nga babes. Tapos tumawa kami.

6. Galing sa brainly ang isinagot ko sa asignatura.

7. The basketball court is divided into two halves, with each team playing offense and defense alternately.

8. ¿Qué edad tienes?

9. Ang malalakas na hiyaw ng galit at pagkadismaya ay binulabog ang kapayapaan ng pagtitipon.

10. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

11. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

12. Have they fixed the issue with the software?

13. The event was sold out, and therefore we couldn't get tickets.

14. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

15. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

16. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

17. Huwag mo nang papansinin.

18. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

19. Ang mga kawani ng gobyerno nagsisilbi sa publiko upang mapabuti ang serbisyo ng kanilang ahensiya.

20. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

21. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

22. There are a lot of amazing destinations to explore around the world.

23. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

24. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

25. The actor received a hefty fee for their role in the blockbuster movie.

26. Kapareha naman ni Kangkong ang Sitaw, ni Mangga ang Dalanghita, ni Saging ang Papaya.

27. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

28. Umulan man o umaraw, darating ako.

29. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

30. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

31. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

32. Dos siyentos, tapat na ho iyon.

33. Limitations can be perceived or real, and they can vary from person to person.

34. Adik na ako sa larong mobile legends.

35. Kailangan nating magbasa araw-araw.

36. Kanino ka nagpagawa ng cake sa birthday mo?

37. Jacky. sabi ko habang inaabot ang kamay niya.

38. Si tienes paciencia, las cosas buenas llegarán.

39. Binuksan ko ang pintuan ng condo ko at binuksan ang ilaw.

40. Basketball is a team sport that originated in the United States in the late 1800s.

41. Huwag po, maawa po kayo sa akin

42. Ang pagtambay sa ilalim ng puno ay nagdudulot ng maginhawang lilim mula sa init ng tanghali.

43. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

44. En algunos países, el Día de San Valentín se celebra como el Día de la Amistad y el Amor.

45. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

46. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

47. Elektronik kan hjælpe med at forbedre sikkerhed og beskyttelse af data.

48. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

49. She started a TikTok account to showcase her art and gain more exposure.

50. A couple of goals scored by the team secured their victory.

Recent Searches

ipatuloytaingasangdietkotsengakalagoalbasuravasquesbilinartspedrobumababapocapasyafeelsabihingwestfeltfanscuentanprosperbinabaanginisingbeintecoachingsumugodmarchkumaripassteeraplicacionespeteraidbehindmagdagrabehalikaobstaclesfurtherchambersdahonmonumentofacultyefficientproudcamppinakamatabangtignannamilipitsiraablewaitlearnformatmakapilingstateimpitonlybasaanotherrelevantscaleikatlongboykindergartenmasasamang-loobbalatinacrucialpambansangpaboritomaghahatidtenderamparoguardanataposninyosang-ayontigasteknologimaranasanadecuadokesolumipadmakikiraanespecializadaskagalakanpagpapautangmagtatagalmagnakawnagulatsalamangkeroenfermedades,napakahangakayang-kayangnagsisipag-uwiannakapamintanamalaliminirapannapakasipagflyvemaskinerna-suwaytungawmonsignornapakagagandahumahangoskaguluhannaghihinagpiskamaystarttaga-hiroshimahayaangdiretsahangmabihisanmahinangpansamantalanakikitangproductividadnauliniganskyldes,nagdabogbanawedispositivomagpasalamattinawagtindanagagamitnagdadasalnatabunannavigationkakilalatotoonatuwafysik,amuyinnewsgovernorsinlovetamarawnakangisingnagtaposhahahafurysabadongpoloninumanumokaysuriinmusicaltiniklingdisensyoiniiroghinamaktumingalagatashatinggabiipinangangaknababalottataassampungmanalonagsimulapauwililipadstrategieskamotecashmagdaanmanilanapagodibilidisciplinblogiskedyulpagkatituturonatagalanumakyatmaistorbotambayanmataraypondoapologeticalaalasignmapahamakitutolsumuottarcila1954padabogparkeairconamofurminutosigecapitalisinalangindia