Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Nous avons choisi un thème de mariage champêtre.

2. Sino ba talaga ang tatay mo?

3. Nagpatingin ang bata sa albularyo matapos siyang makagat ng aso.

4.

5. ¿Cuánto cuesta esto?

6. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

7. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

8. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

9. Twitter allows users to send direct messages (DMs) to each other for private conversations.

10. Sumali ako sa Filipino Students Association.

11. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

12. Sa ilalim ng malawak na upuan, nakita ko ang isang mayabong na lumot.

13. Aalis na ko mamaya papuntang korea.

14. If you think I'm the one who broke the vase, you're barking up the wrong tree.

15. Eine hohe Inflation kann zu einem Anstieg der Zinsen führen, um den Anstieg der Preise auszugleichen.

16.

17. The company used the acquired assets to upgrade its technology.

18. Lulusog ka kung kakain ka ng maraming gulay.

19. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng lakas at inspirasyon sa akin.

20. Miguel Ángel es conocido por sus esculturas, pinturas y arquitectura.

21. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

22. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

23. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

24. Tuwid ang tindig nito at halos hindi yumuyuko kahit may pasang balde ng tubig; tila sino mang masasalubong sa daan ay kayang-kayang sagasaan.

25. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

26. Ang dentista ay maaaring magbigay ng payo tungkol sa tamang pagsisipilyo at pagsisinok ng ngipin.

27. Hallo! - Hello!

28. Don't worry about making it perfect at this stage - just get your ideas down on paper

29. Halatang takot na takot na sya.

30. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

31. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

32. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

33. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

34. Limitations can be a result of fear or lack of confidence.

35. En la realidad, no hay atajos para alcanzar el éxito.

36. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

37. La comida mexicana suele ser muy picante.

38. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

39. Ang hindi magmahal sa sariling wika, ay higit pa ang amoy sa mabahong isda.

40. Ang aming washing machine ay madalas magamit dahil halos araw-araw kaming naglalaba.

41. Kapag nalulong ka na sa droga, mahirap nang makalaya sa hawla nito.

42. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

43. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

44. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

45. Dumating ang mga atleta sa entablado nang limahan.

46. Mahina ang kita ng kanyang ina sa paglalabada; mahina rin ang kanyang kita sa pag-aagwador.

47. Les sciences de la Terre étudient la composition et les processus de la Terre.

48. Ang aming angkan ay nagpapahalaga sa tradisyong pamilya.

49. Les employeurs cherchent souvent des travailleurs expérimentés.

50. Receiving recognition for hard work can create a sense of euphoria and pride.

Recent Searches

bitiwanresortautomationkaindietagadsnaattractivenoblesigemapaibabawkasabaynakukapangyarihancheftelevisedcouldsteerresultidea:tooballsurgeryscienceworryyeahcuandofacultycablecontrolledannaleftprovidedcasesconditioningpotentialroquetrajespeecheslaranganfoundtrentamabibingiayanbumabagmaglakadsarilikaraokebayaniiwanligaligimposiblehadlangniyangpananakotmukhakumantatinderabayadnanaydifferenthulyoenglandminutosamakatwidalapaapyumabongsupilinpanginoonexhaustionpinag-aaralanbumibitiwdahan-dahannahihiyangmagsusunurannagkapilatpakpakdadalawinmakangitimakitamoviesmakikiraanikinagagalakwalkie-talkieskyldes,videosnecesariopansamantalakumakantakapasyahangandahanwalongisinusuotnagdalamaghaponhahahayouthnapuyattumatakbogustobefolkningennaglabavaliosatamarawnapawipagbibirohabitsturonkakayanangpinoypesosmaibabalikibabawundeniablenakikisalomartialenerocareersugatnapapikitothersbarangaymariemalalimdemocracyfreemaulithayitutolthroatlilyimportantesburgermodernmaluwangkadaratingmerrysinagoth-hoydireksyonmarumiganyanlagunacornersirogbinigyanglabanfuryibalikwalisartificialhimselfbornpartsteveangideyabansangsamunagdaosiniwandevelopprogramamemorysequedebatesiginitgitgitanasbilanglumapitmaynilaatpaumanhincanteenlikodhalamanpayapangpadabogmakuhakawayanpangangatawancloseblusarosasandpitobolanabuhaypagapangmalayomassesmakasilongpinaghalokaniyalamighiwaganeed,ginawapagkakalutoferrerpelikula