Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. At leve i overensstemmelse med vores personlige overbevisninger og værdier kan styrke vores samvittighed.

2. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

3. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

4. The eggs are beaten until the yolks and whites are well combined.

5. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

6. I need to check my credit report to ensure there are no errors.

7. I have been watching TV all evening.

8. Ano ang binibili ni Consuelo?

9. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

10. Les personnes âgées peuvent avoir des problèmes de sommeil en raison de la douleur et de l'inconfort.

11. Nogle helte er berømte idrætsstjerner.

12. Umihip ang malamig na hangin, waring may paparating na masamang balita.

13. Mayroon nang natanggap na impormasyon ang pulisya tungkol sa pagkakakilanlan ng salarin.

14. Eating a balanced diet can increase energy levels and improve mood.

15. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

16. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

17. El maíz es un cultivo exigente en nutrientes, por lo que es necesario aplicar abono regularmente

18. Kailangan nating magpakatotoo sa ating mga nararamdaman, samakatuwid.

19. Sa katagalan ng panahon ang lawa ay natuyo at may tumubong isang puno.

20. Sa panahon ng krisis, mahalagang magtulungan ang bawat isa, samakatuwid.

21. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

22. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

23. Siembra las semillas en un lugar protegido durante los primeros días, ya que el maíz es sensible al frío

24. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

25. The United States has a complex political system, with multiple levels of government and political parties.

26. Hindi malaman kung saan nagsuot.

27. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

28. All these years, I have been chasing my passions and following my heart.

29. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

30. Ang mga manggagawa at magsasaka ay kabilang sa sektor ng anak-pawis.

31. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

32. In the dark blue sky you keep

33. Ang panaghoy ng mga hayop sa gubat ay bunga ng pagkawasak ng kanilang tirahan.

34. Saan ka kumuha ng pinamili mo niyan?

35. Cuídate mucho de esas personas, no siempre son lo que parecen.

36. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

37. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

38. Sa oras na makaipon ako, bibili ako ng tiket.

39. Los héroes defienden la justicia y luchan por los derechos de los demás.

40. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

41. Ngayon ang rambutan ay isa sa masasarap na prutas na makikita natin sa ating bansa.

42. He has become a successful entrepreneur.

43. Bakit sila makikikain sa bahay niya?

44. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

45. Der er en række organisationer og programmer, der tilbyder hjælp til mennesker, der kæmper med gamblingafhængighed.

46. Itinali ng hari ang batang higante at pinakawalan ang mga taong nakakulong sa kuweba.

47. Libre ba si Carol sa Martes ng gabi?

48. Miguel Ángel fue un maestro de la técnica de la escultura en mármol.

49. Bis bald! - See you soon!

50. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

Recent Searches

pagodsalahehediagnosticpangingimidiettinanggaplapitandreambuslobotocellphoneeffektivlinggomahahabahousematapospatunayanilocosartistseclipxesumasakitmanghulininongmarmaingbinatakdiyosginaganoonnatalongnataposcarbonaminnoonpitumponghomenogensindewateriniibigmataraycompositoresklasengsitawgardencapacidadbigongfatherkalongproudskyldespinaulananhinilamakalingnakabaonmadadalaexigentekapwadisensyoeksport,paliparincantidadligayaikatlongpagmasdanmaynilatalinobarrerashinalungkatliligawanmagpakaramidecreasednaantigpasasalamatpapayatumindigjeepneyhabitsvictoriadrinkskargahankaniyanagbibigayanpapalapitbusiness:paroroonajerrycafeteriafreelancernapadungawconocidossteerresearch:nakaakmarestawanfridaygranmalikotcallerbilhinschoolslimoslagaslasebidensyatransportnangyario-onlinelumangoysabihinapatnapukulungangasolinakawili-wiliaabotmauupoopisinanai-diallot,pamagatkambingrisebalancesgrammarsinkbilaolalakatedraliilanlarotshirtanitosumagot1954iconicpagkaawagabrielniconatuyosumalaspreadreallymakingandymultopracticesuniqueinalokstonehamlaylaystrategyagosscienceminuteabstainingmalimitlinemakeshaloselectedhulingenterfacultyrobertstatinghapasinhapdijohnlibagmotionqualityeveryimpitinfluencetiyabehindroqueuminomresourceslimitdarkpinilingmetodesharelightstomthereforepromotingalecuentaelectclientesayudaclientscuentanlabingmarkedhelpedhelpkausapinkumakalansingrosatomar