Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Humiwalay siya saglit, I'm so sorry. aniya.

2. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

3. Muli niyang tiningnan ang nakabulagtang si Ogor.

4. Halos maghalinghing na siya sa sobrang pagod.

5. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

6. Don't worry about making it perfect at this stage - just get your ideas down on paper

7. Kung minsan, akala ng mga tao, masungit siya.

8. Maaliwalas ang mukha ni Lola matapos siyang bisitahin.

9. Ah yun ba? Si Anthony, taga ibang department.

10. Les employeurs cherchent souvent des travailleurs expérimentés.

11. Las heridas en áreas articulares o que afectan nervios o vasos sanguíneos pueden requerir de intervención quirúrgica para su reparación.

12. Ang lakas mo kumain para kang buwaya.

13. All is fair in love and war.

14. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

15. Biglang naalaala ni Aling Rosa ang huli niyang sinabi kay Pina, na sana'y magkaroon ito ng maraming mata para makita ang kanyang hinahanap.

16. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

17. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

18. Napagod siya dahil magdamagan ang trabaho.

19. Esta salsa es muy picante, ten cuidado.

20. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

21. Sadyang masarap ang lutong ng tinapay na ito.

22. Bumisita ako sa lola ko noong Mayo.

23. Bakit ganyan buhok mo?

24. Desde la época medieval, se han practicado diferentes géneros musicales, como el canto gregoriano y el canto mozárabe

25. Gusto ko na umuwi ng Pilipinas.

26. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

27. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

28. Hindi ko ho makain dahil napakaalat.

29. We need to reassess the value of our acquired assets.

30. makaraan ang ilang sandali, dahan-dahan at nanlalambot siyang tumindig, nakatuon ang mga mata kay Ogor.

31. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

32. Naupo siya sa sofa at inilagay yung bitbit niya sa mesa.

33. The culprit behind the vandalism was eventually caught and held accountable for their actions.

34. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

35. Maarte siya sa mga kainan kaya hindi siya mahilig sa mga fast food chain.

36. I have been learning to play the piano for six months.

37. Sino ang maghahatid sa akin sa pier?

38. Lumuhod siya sa harap ng altar at tulala sa loob ng ilang minuto.

39. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

40. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

41. La realidad es que todos cometemos errores, pero debemos aprender de ellos.

42. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

43. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

44. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

45. The platform has implemented features to combat cyberbullying and promote a positive online environment.

46. Disente tignan ang kulay puti.

47. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

48. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

49. At samantalang nakadapa, unti-unting nabuo sa walang malamang sulingan niyang mga mata ang mga paang alikabukin.

50. The acquired assets have already started to generate revenue for the company.

Recent Searches

maaripagodmealusodietmangingisdaminutecomplicatederapmalinisguardatools,transparentjokemegetmasdanconectadoshinahangaanlumbayrelativelyipinaexitgenerationertextochamberscomunesakinincreasinglyabstainingelectionnitomaglalakadkapilingcommerceincreasethroughgitnacrossbowcontinuedprovidedandyboytsssmabilisilongkantahancontroversykamisetacausessisentabubongpanghabambuhayresultlockdownpaanomanakbonapilitangisinagotpanayfacekapagpasasaankamandagcafeteriamahirapnaliligobarrocoenviarkikitaraisesikatnakapagreklamomedya-agwadoonnakakunot-noongmagkikitapinagmamalakinakapamintanakayang-kayangmaipantawid-gutomnahuhumalingnakakagalingtumalikodinspirasyonnakagalawmakakatakasikinasasabikmagkasintahanressourcernenalungkotadvertising,nakakatawapitakadiyanmatangkadmahusaypagsahodpaghalikhimihiyawactualidadjuegoskarununganalas-diyesnagnakawbagsakkahaponmakatulogerhvervslivetipinatawagaga-agananalokapintasangpagkaawapananglawincluirpaghuhugastumawakaklasehawaiinanunurinagbagoguhitgubatkampeontog,ginawangpasasalamatkoryentetinungopicturestrentapinauwiumangatmagsisimulahagdanbagamatnakainpauwimagsaingmanonoodmagsimulamakalingkoreamaibakastilahinatidpagongpaaralanmagbagostockssisidlansapatangaliniintayayawlayuanganunupuantalagathroatkasangkapannilalangmisteryotamadsinampalsemillasbeginningslumisanbilimalakikikoipantalopwalongbritishsusulittuvosagapnakakasama10thlorimeaningasulsinapakjudicialnahuliarghpocanilulondiamondtigilfonostonehamhomeworktuwiddinibarpromotingiroglaban