Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

2. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

3. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

4. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

5. En invierno, los días son más cortos y las noches son más largas.

6.

7. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

8. The musician released a series of singles, leading up to the release of her album.

9. Lebih dari sekadar praktik keagamaan, agama juga merupakan bagian penting dalam membentuk moral dan nilai-nilai yang dijunjung tinggi di masyarakat Indonesia.

10. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

11. Ano ang gusto mong gawin kapag walang pasok?

12. La guerra contra las drogas ha sido un tema polémico durante décadas.

13. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

14. Ang mga bata na nakakaranas ng abuso ay nangangailangan ng tulong at suporta mula sa mga otoridad at mga kasamahan sa komunidad.

15. He has bigger fish to fry

16.

17. Walang nakapakinig sa panaghoy ng matandang naglalakad sa lansangan.

18. Mayroon kaming bahay sa Tagaytay.

19. The disagreement between them turned out to be a storm in a teacup.

20. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

21. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

22. Lagi na lamang itong nag fe-facebook.

23. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

24. Ese comportamiento está llamando la atención.

25. Oo, bestfriend ko. May angal ka?

26. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

27. Si daddy ay malakas.

28. The weather was bad, and therefore the game was cancelled.

29. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

30. Masarap higupin ang sinigang na may maraming gulay.

31. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

32. Nagtitinda ang tindera ng prutas.

33. A couple of cups of coffee in the morning help me start my day.

34. Napakalakas ng kanyang halinghing dahil sa sobrang kalungkutan.

35. Kung ako sa kanya, niligawan na kita

36. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

37. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

38. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

39. Bagsak ang ekonomiya ng Pilipinas matapos ang nangyaring kaguluhan.

40.

41. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

42. Nagalit ang diwata sa ginawa ng madamot na matanda.

43. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

44. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

45. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

46. Di ko rin alam kung ano na nga bang nangyayari.

47. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

48. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

49. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

50. Kailan tayo puwedeng magkita ulit?

Recent Searches

ngipingdiettamadkaano-anoestablishedboxnalalaglagmovieskauntikapilingexamplerenatopadrekumbinsihingymbangkouniversalmagbigaywarikainagilityhardintirangipinambilinumerosasnakapuntamagtanimthemkaraokehitsuraiconicproudbarrerascrazymagaling-galingdingginjerrytapewalongbingbingboholangkankingdomdalagangmanuelkinatatakutanproducererbakuranmagpapapagoddiferentescultureshagdananmovingeksempelnaglutoperseverance,renacentistapalitanhinahaploslakadbiglaanlunetastuffedpagsalakayartistasnaka-smirksong-writingnakakagalingrenombretextmaingaypeksmanpaanonapipilitannaabutannagpagupitmakabawitumakasfollowing,manatilinakasahodibinilipacienciatuladhumahagokmahiwagapagkasabiexhaustionmumuntingpinamalagipatunayanloskumaripaskaparehapakukuluanpamagatjingjingeclipxenatalonghanapbuhaymaanghangpitumpongkulungantoykuyaenergiasiaticpinaulananhinatidligayahumihingitumindigpapalapitmatagumpaytools,presleykatagalanbrasobestidaestatesadyangpatientlettersolaralikabukinonlineweresinklinggongitakbasahanlabormallmaskleoremainkapangyarihangdividescommunicationmatababeintebinabaanavailablemaliniselectedappevilcorrectinggirisconditioningplanmaghahandatumamisiconsbuntissakenchambersmasaholestablishmaliwanagtagtuyotnagdaoshumayotinawagtaosadangnahulidumaanoscarshadesniyatransitmulmahalagachoirsirabaketinatawagpilitpayatikinasasabikhealthiermagsisimulajejutinatanongpakakasalanmagawaipabibilanggomalapitflamencopinapakingganniyokulisapfilipinobakasyonkabosesseenfar-reachingmakahingieto