Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

2. The eggs are beaten until the yolks and whites are well combined.

3. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

4. Nagkakaisa ang aming angkan sa pagpapahalaga sa edukasyon.

5. Les écoles offrent des programmes pour aider les étudiants à se préparer aux examens d'entrée à l'université.

6. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

7. Sus gritos están llamando la atención de todos.

8. La realidad es que las cosas no siempre salen como uno espera.

9. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

10. Masyado ka naman nagpapaniwala kay Andrew!

11. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

12. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

13. Certaines personnes sont prêtes à tout pour obtenir de l'argent.

14. Ngunit parang walang puso ang higante.

15. They may draft and introduce bills or resolutions to address specific concerns or promote change.

16. Nagsisunod ang mga kawal sa palasyo pati ng mga nasasakupan.

17. Kumaliwa ka papuntang Masaya Street.

18. Matapos ang matagal na paghihintay, ang aking pag-aalinlangan ay napawi nang dumating ang inaasam kong pagkakataon.

19. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

20. El parto es un proceso natural y hermoso.

21. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

22. Sa kanyang propesyonal na larangan, itinuturing siyang eksperto dahil sa kanyang natatanging abilidad.

23. Ang taong lulong sa droga, ay walang pag-asa.

24. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

25. The sunset view from the beach was absolutely breathtaking.

26. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

27. The platform has implemented features to combat cyberbullying and promote a positive online environment.

28. Pinili kong mag-aral ng Edukasyon upang maging guro din sa hinaharap.

29. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

30. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

31. Sa brainly ako madalas nakakakuha ng ideya.

32. Wag mo ng pag-isipan, dapat pumunta ko.

33. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

34. The Great Wall of China is an impressive wonder of engineering and history.

35. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

36. Nagsisilbi siya bilang doktor upang mapangalagaan ang kalusugan ng kanyang pasyente.

37. Cutting corners on food safety regulations can put people's health at risk.

38. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

39. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

40. Claro que te apoyo en tu decisión, confío en ti.

41. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

42. Nasa labas ng bag ang telepono.

43. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

44. The company's CEO announced plans to acquire more assets in the coming years.

45. Dumilat siya saka tumingin saken.

46. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

47. The acquired assets will give the company a competitive edge.

48. Paano ho ako pupunta sa Palma Hall?

49. A couple of raindrops fell on my face as I walked outside.

50. Nasanay na siyang salatin ang dingding para maghanap ng switch ng ilaw.

Recent Searches

dietaniyamongkaniyangnapakasinungalingbilissantoengkantadanakatapatikinatatakotpublishingtabacoinbasetanyagyeahrestawanleoidea:forskeldumaramibranchpinakabatangsurgeryt-shirtpinakamatabangnakapangasawahotelpanindamakapangyarihangpresence,aktibistahey1920ssasamareviewersabutansamakatwidnewsitinulosiwinasiwasmallnaunatissuedoktoryakapinmakikipaglaromonumentonaninirahanpootkwenta-kwentadagatpagkuwantumakastinaytheirpaderkaramihanmakikinigitinaasinventionpasyapamagatnag-aalaynagdabogbaliwobra-maestramaskwealthbringi-rechargekaragataniyomedicalkotseoverexplainglobesegundoreleasedsakoparawparticipatingcomplicatedmatababetapanalangintaposnandyantopic,sarongahhhhnagbentakananrecentintelligenceposporobutasyorktiyandondenakakarinignabigyanmentalkalongkargahansabadhihigamahiyanahantadpresidentialpamahalaanlearnpropensosino-sinopandemyataongkaloobangnapakamisteryosoipapautangmalagopaulbakasyonhimayinjennymagkakaroonmatayogunfortunatelytvsretirarfridayhiliglayaseconomicmajortemperaturasimbahanyearnaiinitandapit-haponkusineronasahodnatigilanmasiyakmaskarananlalambotbultu-bultongnagyayanglaylayanayinfusionestumatakbosistemasadikumiimiktiradormakatarungangnanghihinamadgrammarunconventionalmakakakaenmakuhaaddresspetpinagtatalunanbagamatnabahalabiologisinabituktokbansangbibilhinginilingkarangalantinahakhelenamagtiwalainastapwedenggawaingintindihinhila-agawanpangalanneed,sinumanginulittobaccoguestsnagagamittwinkledalawangthoughtsnalulungkotulingnagsinegayunpamaniguhitdirectanaglalaroipaliwanag