Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. El internet es una fuente de entretenimiento, como videos, juegos y música.

2. No hay que buscarle cinco patas al gato.

3. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

4. Sa kabila ng panganib, nangahas ang grupo na pumasok sa nasusunog na gusali upang may mailigtas.

5. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

6. Sa harap ng outpost ay huminto ang pulis.

7. Sa bawat kumpetisyon, ipinapakita ni Carlos Yulo ang kahusayan at disiplina ng isang atletang Pilipino.

8. Hinalungkat na niya ang kahong karton na itinuro ng ina.

9. Lack of progress or slow progress towards a goal can also be a source of frustration.

10. Magalang na nagsabi ang estudyante ng "po" at "opo" sa kanyang guro bilang pagpapakita ng respeto.

11. They have been studying math for months.

12. Kucing juga dikenal dengan kebiasaan mereka untuk mengasah kuku di tiang atau benda lainnya.

13. El estudio científico produjo resultados importantes para la medicina.

14. Mas masaya naman ako pag napapasaya kita eh.

15. Nagsmile si Athena tapos nag bow sa kanila.

16. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

17. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

18. Sa pagguhit, mahalaga ang tamang pagkakabalangkas ng mga elemento.

19. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

20. Inumin mo ang gamot nang minsan isang araw.

21. Ano ang ginawa niya pagkatapos ng giyera?

22. Jacky! si Lana ng sagutin ko ang CP ko.

23. Wag kana magselos, mahal naman kita eh.

24. I know I should have apologized sooner, but better late than never, right?

25. Samahan mo muna ako kahit saglit.

26. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

27. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

28. Kebahagiaan adalah hasil dari kepuasan, keseimbangan, dan rasa bersyukur atas apa yang kita miliki.

29. Sobrang mahal ng cellphone ni Joseph.

30. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

31. Einstein was married twice and had three children.

32. Work can be challenging and stressful at times, but can also be rewarding.

33. Nagkapilat ako dahil malalim ang sugat ko.

34. Si Ogor ang kinikilalang hari sa gripo.

35. Ang paggamit ng droga ay maaaring magdulot ng pagkawala ng trabaho, pamilya, at mga kaibigan dahil sa mga problemang may kinalaman sa droga.

36. Natawa kami sa inasta ni Sara dahil para siyang bata.

37. Después de lavar la ropa, la puse a secar al sol.

38. Umalis siya upang hanapin ang sandok na hinahanap.

39. Limitations can be financial, such as a lack of resources to pursue education or travel.

40. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

41. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

42. Muchas serpientes venenosas poseen colmillos huecos a través de los cuales inyectan veneno en sus presas.

43. The Ugly Duckling is a story about a little bird who doesn't fit in until he discovers he's actually a beautiful swan.

44. LeBron James is a dominant force in the NBA and has won multiple championships.

45. Sinunod ni Mang Kandoy ang bilin ni Rodona.

46. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

47. Kumakain ka ba ng maanghang na pagkain?

48. Malapit na ang pyesta sa amin.

49. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

50. There are a lot of reasons why I love living in this city.

Recent Searches

diettinanggapnasabingbuslosetyembresalarinmerrykwebaeuphorickaarawangiveresortpresence,stylesusasufferprimerpartybecomelutopeepelitefiaramdamsiempremarioipinadalailangbairdmaluwangrosapopcorntenderalinscientificpshsystematiskarguebriefutilizaconnectingbalingartsanaydalawbingostillinantayburgergisingpumatolnegosyomabibingimaingatmanlalakbaydatapwatvaccinesadverselysumugodriskelectionsalingmeetipatuloynatingalabotebumababaipagamotbugtongkwebangklimabienhydelspecial1876mentalhanpatutunguhankadaratingginisingpasoktakesnaritowatchkitangpiecesimaginationpetsareservedreservationtenroboticburmafarmpagdatingdingcountriesshockwalletmacadamiakamatisjamesbelievedroomlaylayinalalayanstaplesumalilayasmulamillionspyestalumiwagtamislibreroonsedentaryzoomstudents4thkartonteamchambersabonowalissincestorepuedehardkingclassroomataquesmasasabiulosupilinsnaviewstrainingmobilepasyadivideshighagastandartificialcesbokmapapacallpreviouslypersonsgenerateauthorobstacleshangaringideyacommunicateamingevilirogformtiyareadingechaveformaipapahingaclientessteerfredmind:seenanimomaliksiblusainaloktechnologicalalignssambitcreatingrepresentedimprovedinternalbasacontentpersistent,statingcommercestreamingcasesrelevantkitsusunodshifteffectmapadaliandroidformsjoedependinglive