Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

2. Binabarat niya ang mga paninda sa siyudad.

3. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

4. Dogs can provide emotional support and comfort to people with mental health conditions.

5. Algunas personas se dedican a crear arte como su profesión.

6. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

7. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

8. Hiram na libro ang ginamit ko para sa aking research paper.

9. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

10. Mahirap bilangin ang mga bituin sa langit.

11. Las escuelas públicas son financiadas por el estado y son gratuitas para los estudiantes.

12. Ang ganda ng sapatos ni Junjun.

13. Ang tulang ito ay may petsang 11 Hulyo 1973.

14. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

15. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

16. Lumayo siya sa amin, waring nais niyang mapag-isa.

17. Il est également important de célébrer les petites victoires en cours de route pour rester motivé.

18. Napuyat na ako kakaantay sa yo.

19. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

20. Ang mga palaisipan ay maaaring nagdudulot ng pag-unlad sa mga larangan tulad ng agham, teknolohiya, at sining.

21. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

22. Malaki at mabilis ang eroplano.

23. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

24. Ang maliit na aso ay tuwang-tuwang hinahabol ang bola.

25. Les enfants commencent l'école maternelle à l'âge de 3 ans.

26. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

27. Mabango ang mga bulaklak sa sala.

28. Pagdating namin dun eh walang tao.

29. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

30. Las hojas de papel se pueden reciclar para hacer papel nuevo.

31. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

32. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

33. Magtanim na lang tayo ng puno para makatulong sa kalikasan.

34. Las redes sociales pueden ser un lugar para descubrir nuevos productos y tendencias.

35. **You've got one text message**

36. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

37. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

38. Madalas na naglulusak sa dumi ang mga bakuran.

39. A lot of birds were chirping in the trees, signaling the start of spring.

40. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

41. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

42. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

43. Sa gitna ng dilim, natagpuan niya ang liwanag sa pamamagitan ng pag-iisa.

44. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

45. Uno de mis pasatiempos favoritos es leer novelas de misterio.

46. Makapangyarihan ang salita.

47. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

48. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

49. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

50. Ang pang-aabuso sa droga ay nagdudulot ng malalang problema sa kalusugan ng mga tao.

Recent Searches

dietlibrengimaginationproduciripagamotvideoayudalarrypetsawidejackztrafficgabesumamahamakmapadaliumikottargetdeviceslockdownpdahoweverinfluentialbubongeksaytedtuwidtwinkleforcescharmingmerchandisepatrickincludeactorcertainevolvedmultobetaumarawstopdigitalfaceeksamresourcesnaispagamutansuriindiliginibighalinglingfriehabitbilhinhinahanapafterutak-biyanormalvibratelandetliigtaongvistkasamahannagtitindanakalilipasnagpapasasakailangusalibestfriendmagkaibangmaisippawisbulaklakdonationsbagamatpagsuboklunaspropensomajorcaracterizasumuotmuchostablenakuhangrepresentativelaki-lakinagmadalingbunutanekonomiyalalakiculturemedicinepagkuwantahananfulfillmentvarietyalagaindividualsmananalolalonglaybrariyorkkanmatangallottedrightbabeprogramanaapektuhantanggalinkagipitanmanatilimagsi-skiingkanikanilangsunud-sunuransulyapyoutube,bisitamagsaingsmilekabarkadatawatiyannaminfederalnapapatinginprobinsyanatitiranakaluhodmakikipag-duetohinagud-hagodculturaagwadordistansyapunongkahoymagpa-checkupmakalaglag-pantydekorasyonnagkasunogpag-asainilalabassalenagtuturoadverseinvestingmagpaliwanagmagkaibapagtiisantamangtumalimkinalilibinganmagturonapatulalamagpapigilsinusuklalyanhalu-halomaruruminareklamomagpakaramikristomakilalanakauslingbiyayangbihirangnatuwapagbigyannangapatdannahahalinhanutilizarpresencenagitlahumigaampliaisinalaysayumupotanyagmabigyanumulanbiglaanmatiwasaybagalkasamafriendtrajesapotnapagodbilanggosalesself-defenselipatconclusionsumigawnaggaladailybumigaylenguajekumukulochooserenatowasaklto