Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang galing nyang mag bake ng cake!

2. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

3. He was already feeling sad, and then his pet passed away. That really added insult to injury.

4. Anong linya ho ang papuntang Monumento?

5. Mayroon pa ho sana akong gustong itanong.

6. Ang ganda naman ng bago mong phone.

7. Napakaganda ng tanawin sa dapit-hapon.

8. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

9. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

10. Hindi ko kayang itago ito, gusto kong malaman mo na sana pwede ba kitang mahalin?

11. Kaninang umaga ay bumigay na ng tuluyan ang kanyang katawan, wala ng nagawa ang mga doktor.

12. Malaya na si Jerry matapos itong makulong ng limang taon.

13. Bumagsak ang dilim sa kalsada ng biglaan kaming tumama sa ilaw ng poste ng kuryente.

14. Ang galing nya maglaro ng mobile legends.

15. Je suis en train de faire la vaisselle.

16. Awitan mo ang bata para makatulog siya.

17. May nakita ka bang maganda? O kabigha bighani?

18. Sa pagbisita niya sa museo, pinagmamasdan niya ang mga antique na kagamitan.

19. The potential for human creativity is immeasurable.

20. Dahil sa sobrang ganda ng lugar, nahuhumaling ako sa pagba-vacation sa ibang bansa.

21. Sí, claro, puedo confirmar tu reserva.

22. Tomar decisiones que están en línea con nuestra conciencia puede ayudarnos a construir una vida significativa y satisfactoria.

23. You got it all You got it all You got it all

24. Pumupunta kami sa sementeryo tuwing undas.

25. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

26. Nakaupo ako nang matagal sa sinehan.

27. Isang araw sa kanyang pamamasyal ay may nakilala siyang isang bagong mukha.

28. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

29. Bitte schön! - You're welcome!

30. Mga nuno, patawarin po ninyo ang aking anak.

31. Hvis man oplever smerter eller ubehag under træning, er det vigtigt at stoppe og konsultere en sundhedsprofessionel.

32. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

33. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

34. Banyak jalan menuju Roma.

35. Some people view money as a measure of success and achievement, while others prioritize other values.

36. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

37. Pinili kong magtrabaho mula sa bahay upang makasama ang aking mga anak, bagkus may mga oras na rin na kailangan akong pumasok sa opisina.

38. Nakikita mo ba si Athena ngayon?

39. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

40. Mon mari et moi sommes mariés depuis 10 ans.

41. Nag-usap kami kamakalawa ng tanghali.

42. Ayaw ng Datung paniwalaan ang mga aral na itinuturo sa Katolisismo.

43. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

44. Este año planeamos viajar a España durante las vacaciones de verano.

45. La fotosíntesis es el proceso mediante el cual las plantas convierten la luz solar en energía.

46. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

47. Bukas ang biyahe ko papuntang Manila.

48. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

49. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

50. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

Recent Searches

dietnakainproductionbeganencompasseshehetaingapang-aasarfar-reachingdreamorderinsnobkablancareconsistexcusedaanheycongratsprosperimaginationcoaching:damityanintroducedogbiggestreducedrestawanpageideasprovekumaripashumanosreservednathanproyektoparticipatingsorrynilinishayopprofessionaliconstarted:kampomentalpinahalatapublishingresultfuncionarmulti-billionnakatapatlivedenperanameataquesmaratingcontentnotebookinternabroadcastssuccesshaloswaysmichaelimprovemaputipowersdeclarewouldcirclethingcomunicarsemanagerpublishedlutuincertainevolveableinteractdissedarnasantolibrarynapawinagtanghalianbarangaypigilankamaopgavernakahugpagtangisnyaaayusincharmingenhedernareklamorespectnamumuongangkingpagtangomadamingnakakabangonkabibibetweennatatakottinderakinissnatinagelectionpulang-pulagonemakatayosuccessfulgraphicmakahihigittimeeventostransparentpersontanongkakaroonmahirapdaraanrisenanlilimoseducativasbagaycynthiaemnermabiropagbabagoheldtaasnaguguluhantatanggapinikinatatakotcomplextelebisyonmainstreamwalaupangperohappenedalimentoinumintinatawagnakumbinsinagtatamponakakagalingmagtanghalianpaghalakhakmakakawawanakapagsabiiskoalas-diyesnakahigangnagsunuranmagbayadmiyerkolesnaniniwalakumikinigbefolkningen,nag-emailcoatmediabinabaditonananaginiplipadmakikiraanmagkakailapaglalayagnagulatmaglalakadikinamataypagkakayakapnakagalawmakikipag-duetorevolucionadoeskuwelapagtatanongsanakinabubuhaylibongkarunungannakatayopamilyangkasamahannagkwentonahuhumalingdisenyongicenag-angatpupuntahanmakasilongestudyanteinasikasomagpagaling