Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang tissue ay mabilis higupin ang tubig.

2. Natapos ko ang aking thesis sa dakong huli bago ko ito isinumite.

3. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

4. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

5. Los padres sienten un inmenso amor y conexión instantánea con su bebé desde el momento del nacimiento.

6. A lot of rain caused flooding in the streets.

7. Buhay ay di ganyan.

8. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

9. Nakasandig ang ulo sa tagpiang dingding.

10. Mabait ang nanay ni Julius.

11. Me duele la cabeza. (My head hurts.)

12. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

13. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

14. The pneumonia vaccine is recommended for those over the age of 65.

15. Malapit na naman ang eleksyon.

16. Il faut que j'aille faire des courses ce soir.

17. Malaya na si Jerry matapos itong makulong ng limang taon.

18. Patulog na ako nang ginising mo ako.

19. Tingnan natin ang temperatura mo.

20. Nang matanggap ko ang pagbati at papuri sa aking gawa, ang aking kaba at pag-aalinlangan ay napawi.

21. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

22. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

23. Las plantas carnívoras son capaces de atrapar y digerir insectos u otros pequeños animales para obtener nutrientes adicionales.

24. Oo. Tatawagan ka daw niya pag nandyan na siya.

25. Sa gitna ng krisis, marami ang nagkakaroon ng agam-agam sa kanilang kinabukasan.

26. Awitan mo ang bata para makatulog siya.

27. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

28. Gusto ko na umuwi ng Pilipinas.

29. Users can follow other accounts to see their tweets in their timeline.

30. Ok lang.. iintayin na lang kita.

31. Kung ako si Maico? Malamang magwawala ako. aniya.

32. Maliit lang ang kusina ni Lola Oliva.

33. Hitik na hitik sa bunga ang nasabing puno.

34. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

35. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

36. Napangiti ako bigla. Yun lang ba yung problema niya?

37. Congress, is responsible for making laws

38. Einstein's theory of general relativity revolutionized our understanding of gravity and space-time.

39. Climbing to the top of a mountain can create a sense of euphoria and achievement.

40. may butil na rin ng pawis sa kanyang ilong.

41. Ang mga bunga ay nagkaroon ng malaki at maraming tinik na katulad ng rimas.

42. Many people go to Boracay in the summer.

43. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

44. Araw araw niyang dinadasal ito.

45. En sund samvittighed kan hjælpe os med at tage ansvar for vores liv og handlinger.

46. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

47. Every cloud has a silver lining

48. Siya ang nagpatuloy sa pag-aagwador.

49. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

50. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

Recent Searches

semillasarbejderdipangdietpaskohaykikobilaosciencelinepaareferslackmamitekstmalabothenbugtongdrayberheykaringpinalakingtargetgamitconectanmagingstorehalamanhiteyesumalanotmacadamiablessprotestatiyathemthoughtshimselfflyplannothingboyceschefmakapilingincreasemediumhateandroidnotebookalignsimprovedestablishednamungapointipihitinspirasyonnagbiyayapinagpatuloymumurakinikitaadvertising,travelmalasutlacitizenspanghihiyangsakristannagtataastiniradorkasangkapannagwelgamakangitimahahanaysaritabayawaknaiyakmahuhusaypinamalaginapagtantobagsakfestivalespaghaharutanpansamantalanakakamitnagwagimagkasamatinawagnangangalitnamataycountriesmagturoistasyonkanginajingjingyumaostorymaghahabikinalalagyanemocioneskinakainoperativoskapatagancanteenenglishmasaholafternoonmabigyansakenbayanimadadalaunanumupokilaydisensyogiraypagsidlannaglabatirangniyobinawianaayusinmanalomaisusuotaregladoawitinnilayuantanawsinisiwondersisipainninyongniyakahusayankasoyartesapotexperts,rememberedinventadosabogtasaaksidenteltodahilsumasakityeypinagkasundosapatinimbitapamimilhinghinogasthmamagisingpongbinatakdinanassoccerwaritilladditionally,grinsreservespulubidyanlagimulscientistfar-reachingsnastartedprovefaultnaiinggitsecarseconditioningbabedumaramiemphasizedkinatatakutanpresidentialikinagagalakkinamumuhiandebateskaloobangnagpagupitkinapanayammakahiramnananalongpamilihanpinagawasundalostaypaninigasmahalsisikatpanatagnahantadgarbansoskailanman