Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. If you keep beating around the bush, we'll never get anywhere.

2. Microscopes can magnify objects by up to 1,000 times or more.

3. Eh? Considered bang action figure si spongebob?

4. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

5. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

6. Ilan ang telepono sa bahay ninyo?

7. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

8. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

9. Me encanta pasar tiempo con mis amigos jugando al fútbol.

10. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

11. Aling lapis ang pinakamahaba?

12. Ibinigay niya ang kanyang panahon upang magbigay ng kaunting kasiyahan sa mga taong malungkot.

13. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

14. Ngunit ang bata ay mahinahong sumagot.

15. Ano ang isinusuot ng mga estudyante?

16. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

17. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

18. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

19. Paano ako pupunta sa airport?

20. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

21. La tos puede ser tratada con terapia respiratoria, como ejercicios de respiración y entrenamiento muscular.

22. Magaling magturo ang aking teacher.

23. Ang apoy sa kalan ay nagbabaga pa rin kahit patay na ang apoy.

24. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

25. At blive kvinde handler også om at finde sin egen stil og identitet.

26. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

27. I know this project is difficult, but we have to keep working hard - no pain, no gain.

28. Hindi maganda ang resulta ng ginawang pag susulit ni Mikaela.

29. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

30. Hit the hay.

31. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

32. Hihiga na sana ako nang may kumatok sa pinto.

33. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

34. Ang pag-aaral ng panitikan ay nagbibigay daan sa mas malalim na pag-unawa sa buhay.

35. Sa dakong huli ko lang narealize na mali ang ginawa ko.

36. There are so many coffee shops in this city, they're a dime a dozen.

37. She is designing a new website.

38. Protecting the environment can also improve public health by reducing exposure to harmful pollutants and chemicals.

39. Disse virksomheder er ofte i førende positioner inden for deres respektive brancher, og de er med til at sikre, at Danmark har en høj grad af økonomisk vækst

40. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

41. May lumabas umanong bagong sakit na dapat pag-ingatan ng publiko.

42. She admires the beauty of nature and spends time exploring the outdoors.

43. Pinaluto ko ang adobo sa nanay ko.

44. Selamat pagi, bagaimana kabar Anda? - Good morning, how are you?

45. Have we completed the project on time?

46. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

47. Bless you.. tugon ko sa biglang pagbahing nya.

48. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

49. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

50. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

Recent Searches

dietbotantekasingtigastaaslandolintafar-reachingmansanasitutoldangeroussoremaalogrosepakpakteleviewingrailwaysarghsumabogmalagotendermisuseddahonfloorpostermeanspaghettispasaringinterestrisk1973maaringenergiplatohimselfdebatesdeclarerelevantlayunindollaryonbakeconnectionpersonsideaeksamlearningdevelopmentlibrodulolutuinsupportlasingfeedbackalignsiginitgitpagkalungkotgumuhitvictoriakamukhalumipadfonomerchandisebinabaratentrynagkantahanmahalbiglaanpeacemaranasangabinag-aralpagkapasokcombinedkahulugantalanapahintoanak-mahirapmagkaparehonahintakutangabingwinsbalotnakangitingmisteryointensidadsarilingosakapawiinmatipunotinapaycirclekaibaoscarmaarikalabawdaangmahabangnagsalitagodmatagpuanvirksomheder,napahingaevolvedpaghihingalonapakasipaghitanabighaninakapaligidgagawinpagdukwangmahiwagangpaglalabadanakatuwaangmagkaibigangayunmannapakatalinonag-aalanganeskuwelahanmanamis-namisnakapagreklamoaraw-arawnagsusulatnakakapamasyalkumembut-kembotnagpapaniwalanamulaklakoktubrenakatiramanggagalingjobslumiwanagpakanta-kantangnagtungosabadongnagtatanongmapayapagrupomakatatlotradisyonngumingisitutungoinakalamahinogsundalonamataypagkasabitumatanglawnasagutannapakabilisminatamissasakaymaghahabipatakbofrancisconagtataenanunuksolangpigilansumasayawniyontinikmanafternoonjeepneynatitiyaktumingalanaliligosugatangnatakotconclusion,banalbumaliknapadpadmusicalhinagismakapalagdisensyohalinglingnatatanawplanning,magdilimbibigyanipinangangakcurtainsctricaspakibigaykusinaemocionalibabawlalongwaiterbandanararapatsumimangotgulangrepublicanbirdsjobnapadaanpanindang