Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Uh huh, are you wishing for something?

2. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

3. OMG. Makalaglag-panty si Kuya!!

4. You can't judge a book by its cover.

5. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

6. Using the special pronoun Kita

7. He has been practicing yoga for years.

8. Si Tom ay nag-aapuhap ng paumanhin sa kanyang mga kaibigan matapos ang kanilang pag-aaway.

9. Heto ho ang isang daang piso.

10. Siya ang may pinakamataas na grado sa klase, samakatuwid, siya ang napiling valedictorian.

11. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

12. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

13. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

14. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

15. Ginagamit ang "ani" bilang pamalit sa "sabi ni" kapag inilalahad ang sinabi ng isang tao sa isang usapan o kuwento.

16. Bakit ba nagkaroon ng landslide at baha?

17. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

18. Estoy sudando mucho. (I'm sweating a lot.)

19.

20. Kapag aking sabihing minamahal kita.

21. Hindi mo gusto ang alok na trabaho? Kung gayon, maaari kang maghanap ng ibang oportunidad.

22. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

23. The telephone has also had an impact on entertainment

24. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

25. Bakit siya ginaganoon ni Ogor?

26. Superman possesses incredible strength and the ability to fly.

27. Kebahagiaan adalah keadaan emosional yang diinginkan oleh setiap orang.

28. Gaano kalaki ho ang gusto niyo?

29. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

30. Sa pagbisita sa hardin, ang mga bulaklak ay nagbigay ng mabangong amoy at kagandahan sa kapaligiran.

31. Talaga ba Sharmaine?

32. Aku merindukanmu, sayang. (I miss you, dear.)

33. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

34. Akin na kamay mo.

35. May klase ako tuwing Lunes at Miyerkules.

36. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

37. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

38. Ang bilis nya natapos maligo.

39. Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

40. Kumaliwa ka papuntang Masaya Street.

41. Busy sa paglalaba si Aling Maria.

42. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

43. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

44. Inaamin ko na ang pagkakamali ko.

45. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

46. I like how the website has a blog section where users can read about various topics.

47. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

48. Ang agam-agam ay maaaring maging hadlang sa pagpapasiya at pagkilos ng tao.

49. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

50. Hindi. Ipinangangak ako sa Cebu.

Recent Searches

dietkalayuanabanganbinibilanghampasboksinglaloislandfraotrasnakakarinigbumababatoktumahimikfertilizernanghihinamadnagplaynakinigbagoexplainfaultworkshoplearnoutlineipinagbilingibonkasaganaanbutchnagpabakunagasolinainilistapagkapasokmagbantaynamumutlabumabahadisyembrehinugothumarapdispositivosisinakripisyoniyognandiyanbilihinbehindpunung-punohidingdontneverlikoduniversalganaincidencealambellgodnanooddreamkalikasaniligtasnagsinepasaheronatigilanbecameyaripagkagisingkingreplacedrevolucionadobilaorollnuclearpanoinfluencemalikotboyetlumulusobnapahintolimosallottedpakikipaglabannapakalusogreturnedngipingtelefonginagawapunongkahoybuhoksurgerymahawaannakilalanauntoghulubumuhospitosoonteacherdiagnosespagkainissinungalingpaglalayagbigongtenerpooktanyaghapasinkakayanangbusiness,karaokefitkinakasakitredesipinadumaanroofstockikinabitposporonangangaralphilippinelangkayexitorderinfederaldiscipliner,palakaconsistteknolohiyarememberpatakbowaiteripapainitratekalalarodisyemprecynthiakasalukuyanestablishikinamataysumigawpaparusahanmakaiponpssssteerdadalawbernardoedsatoymasayang-masayaipanlinisalaykabibiumiyaknanunuksogodtpamamagitanpinalayassumpaindulawriting,satisfactionclientssulyapwonderdahilboracaysparksisikatforståpansinpumulotpusaboholcleanmarielmatabangnobodyabletumatawagsahigsang-ayonlossleytelikeskakaantaydumadatingnagliwanagsinumangtagaytayelevatordumilimaggressionsequekatutubokulangmaranasanmasayang-masayangnuevoslaylayanimgrammar