Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. A couple of books on the shelf caught my eye.

2. My birthday falls on a public holiday this year.

3. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

4. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

5. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

6. Las hojas de mi planta de tomate se ven amarillentas y enfermas.

7. They have been dancing for hours.

8. The French omelette is a classic version known for its smooth and silky texture.

9. Some dog breeds are better suited for certain lifestyles and living environments.

10. Pero bigla na lang siyang hindi nagpakita.

11. He was already feeling sad, and then his pet passed away. That really added insult to injury.

12. Ang mga tao ay pumili ng panibagong Sultan at kinalimutan na si Sultan Barabas.

13. Gusto ko hong pumunta sa Pearl Farm.

14. At hindi papayag ang pusong ito.

15. A penny saved is a penny earned

16. Los alimentos ricos en antioxidantes, como las bayas y los vegetales de hoja verde, pueden ayudar a prevenir enfermedades crónicas.

17. Congress, is responsible for making laws

18. Mag-usap tayo sa WhatsApp o Line.

19. Television is a medium that has become a staple in most households around the world

20. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

21. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

22. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

23. Después de hacer la compra en el supermercado, fui a casa.

24. Wala ka naman palang pupuntahan eh, tara na lang umuwi na!

25. May salbaheng aso ang pinsan ko.

26. Ang mahal pala ng iPhone, sobra!

27. They launched the project despite knowing how risky it was due to time constraints.

28. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

29. Sa ikauunlad ng bayan, disiplina ang kailangan.

30. Time management skills are important for balancing work responsibilities and personal life.

31. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

32. Forgiveness allows us to let go of the pain and move forward with our lives.

33. I always feel grateful for another year of life on my birthday.

34. Los héroes pueden tener habilidades sobresalientes, pero también muestran compasión y empatía hacia los demás.

35. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

36. Muchas personas disfrutan tocando instrumentos musicales como hobby.

37. May tatlong bituin ang watawat ng Pilipinas.

38. TikTok has become a popular platform for influencers and content creators to build their audience.

39. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

40. Hindi ko maintindihan kung bakit kailangan pang magpaplastikan kung maaari naman nating sabihin ang totoo.

41. She has been preparing for the exam for weeks.

42. In the years following his death, Presley's legacy has continued to grow

43. Emphasis can be used to provide clarity and direction in writing.

44. Kanino makikipaglaro si Marilou?

45. Ang pagdating ng mahigpit na bagyo ay nagdulot ng malalakas na alon at binulabog ang mga bayan sa tabing-dagat.

46. Honesty is the best policy.

47. Ang mga natatanging kontribusyon ng mga siyentipiko sa kanilang larangan ay dapat na itinuring at ipinagmamalaki.

48. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

49. Hindi umimik si Aling Marta habang minamasdan ang bata.

50.

Recent Searches

benefitsbecomingdietpiecesweremaranasanamongpaki-ulitbrancheskailanlaylaynabighanihumihingikasiyahanpioneerbibigyansaidmasaholmabutingpakilutophilosophicaltawakondisyonmatutongagilanakakarinigmahabolgigisingangkopinfusionessalesasahangamitinnageespadahanpagsumamoencuestasgurotatanggapinbutterflybopolsngingisi-ngisingngipingdevelopedmakikipag-duetopagpapakalatpotentialkumaliwagandapresencewalngfollowingstaplediyaryopwedengmaistorbosallysolarbetweenubodnagpabotnakatingingworkdaynatakottaingalinawtugonnilinisconectadosgawainkalakingmagsungitisinalaysaygloballatestnapapadaannagtuturoitinulosnagsilapitworddilimgrammarnutsmultagaexitadventpagelumikhamagpaliwanagleftteachprocessbitiwanlorinetobusilakandamingaraw-na-suwaymagalangsparknaminmagandangkenjinapakagandamasungitbuhawiseasonpaghahabipangalaneasyanimkanya-kanyangmanlalakbayeducationhinamonipipilitconcernsjackzbinabanasasalinancommunicationlossmulti-billionviewsariwahitkaliwamayabongpasyalantumunogtobaccokaparehakidlatmuchosapollonapasubsobkumaenhinalungkatpagkakilanlanoveralltumigilhappierusonabigkastools,kararatingnakapasokkababalaghangradyomakapangyarihangshiphinandenproducts:nakatulongpinakamatapatnalalagasmelissapangangailangannapakabiliskaragatanbangkadalhanlumuhodfarmlumakipooksumabogtayobinawiannagmungkahihamaksasayawinferrerpublicationasknamatayseryosongformsprogrammingsedentarymedya-agwatypessteveuugud-ugodjamesdoingyanbigasrepresentativekaibiganrestawaninilabasprosperdontisubonabuhaytrenpyestaactor