Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Paano kung hindi maayos ang aircon?

2. Ang calcium ay kailangan ng ating katawan upang tumibay pa ang buto.

3. Sa ganang iyo, dapat bang manatili sa kanilang posisyon ang mga opisyal na hindi epektibo?

4. Kasya kay Suzette ang blusang na ito.

5. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

6. The Colosseum in Rome is a remarkable wonder of ancient Roman architecture.

7. It’s risky to eat raw seafood if it’s not prepared properly.

8. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

9. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

10. Nakikita ko ang halinghing ng mga bata habang naglalaro sa parke.

11. The United States is the world's largest economy and a global economic superpower.

12. Hinawakan ko yun yung kamay niya tapos nag smile at nag nod.

13. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

14. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

15. Ang pagbibigay ng oras at pag-aalaga sa mga alagang hayop ay nakagagamot sa aking kalooban at nagbibigay ng pagmamahal.

16. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

17. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

18. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

19. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

20. El maíz necesita sol y un suelo rico en nutrientes

21. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

22. Adopting a pet from a shelter can provide a loving home for an animal in need.

23. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

24. Put all your eggs in one basket

25. Lumingon ako para harapin si Kenji.

26. Nakaka-bwisit talaga ang nangyari kanina.

27. The presentation was absolutely flawless; you did a great job.

28. Ang mga pabango sa tindahan ay nag-aalok ng iba't ibang mga amoy, mula sa mabango hanggang sa matapang.

29. Nakangiting sagot ni Helena sa binata.

30. Pumapasok siya sa unibersidad araw-araw.

31. Magandang umaga po, mga mahal na manonood.

32. Mabini ang sumulat ng konstitusyon ng unang Republika ng Pilipinas.

33. Binibigyang halaga ng mga Pilipino ang talambuhay ni Dr. Jose Rizal bilang isang pambansang bayani.

34. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

35. The business started to gain momentum after a successful marketing campaign.

36. Ang laki nang mga gusali sa maynila!

37. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

38. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

39. Arbejdsgivere kan fremme mangfoldighed og inklusion på arbejdspladsen for at skabe en retfærdig arbejdsmiljø for alle.

40. Sumama ka sa akin!

41. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

42. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

43. Sa dapit-hapon, masarap magpakalma sa gitna ng kagandahan ng kalikasan.

44. Halos lahat ng pwede nyang bilihin ay nasa Lazada na.

45. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

46. En España, la música tiene una rica historia y diversidad

47. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

48. There are a lot of books on the shelf that I want to read.

49. Maaliwalas ang paligid sa bukid tuwing madaling araw

50. Ang mumura ng bilihin sa Shopee.

Recent Searches

dietbitiwan18thespadachadsusunduinsoonpumuntaguardauncheckedadditionactinginuminsurgerypinunitditoprofessionalconventionalexpertgaanobusinessesartistapinyapebrerosumagottagalboypeterspeechbaldetargetvasquesheieksayteddevelopjunjunitemsnamungaconstitutionlibroemphasizedlibagcourtflashgraphiccoughingjoynagngangalangstogayundinobservation,pangungusapsasagotbabasahinmuybabeskasamaanshoesnagwaliskapagtitserkasalmatesanabighanitulisansistersantosmiyerkolespagbibirojanroomtiyacommissionpaumanhinnagagandahanrevolucionadoinferioresbopolsharapinnakaliliyongnatandaanpagtumatawakinantanakabawipaperimaginationpinag-aaralantalinolikasinalalayanregaloproducererkikoeuropebilaodamiwowgalakobstaclesincreasestipintyainkasimalawak3hrssarongdalawangbantulotretirarnanigassakoppaosfysik,umiibigmagamotvaccinespaghangalumabaskadalasmagtakanagsinemagpa-picturepagka-maktolnakapapasongmagpa-ospitalmagsasalitalumakiphilanthropykasintahankahulugannaliwanagansasamahantumutubonagtataaspaglisanmakatiyaksaan-saankwenta-kwentanagtungonakaka-ininspirasyonobra-maestrapatutunguhanngingisi-ngisingpangungutyapinapakiramdamanpakanta-kantanangangaralluluwasbinibiyayaanpagkabuhaypagtataposnagsunuranpaghalakhakkapangyarihant-shirtmakauwisalbahengkondisyonpamasahenakahugprodujonagkasakitlumuwasmaipapautangkomunikasyontog,ipinalutokangitanperyahanngitiautomatiskmaghihintaynabuhayseryosongtumigilenglishnakablueyungsumasayawmarangalbefolkningenpinapakinggannagpasamahabitsiniirogpwestonabiawangtagpiangnaupohihigitmaranasannakainniyomagisippakilagayparaangpiyanoskills