Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

2. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

3. Pumunta ako sa Iloilo noong tag-araw.

4. La música clásica tiene una belleza sublime que trasciende el tiempo.

5. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

6. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

7. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

8. And often through my curtains peep

9. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

10. Naglinis kami ng bahay noong Linggo.

11. Nagluto ng pansit ang nanay niya.

12. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

13. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

14. Nag-uumigting ang kanyang mga ugat

15. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

16. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

17. Binanggit ko na sa kanila ang aking pagtutol sa kanilang desisyon ngunit hindi nila ako pinakinggan.

18. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

19. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

20. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

21. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

22. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

23. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

24. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

25. Las hojas de papel se pueden reciclar para hacer papel nuevo.

26. Under fødslen går kroppen gennem en intens og smertefuld proces.

27. Ipaghugas mo siya ng mga Maghugas ka ng mga

28. Magkano ang arkila ng bisikleta?

29. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

30. El tiempo todo lo cura.

31. Sa paligsahan, pumasok sa entablado ang mga kalahok nang limahan.

32. Emphasis is an important tool in public speaking and effective communication.

33. I baked a delicious chocolate cake for my friend's birthday.

34. La agricultura es una carrera honorable y vital que ha existido desde tiempos antiguos.

35. They are hiking in the mountains.

36. He has been repairing the car for hours.

37. El coche deportivo que acaba de pasar está llamando la atención de muchos conductores.

38. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

39. She always submits her assignments early because she knows the early bird gets the worm.

40. Claro, haré todo lo posible por resolver el problema.

41. Napapalibutan ako ng poot habang pinagmamasdan ko ang mga taong nagtataksil sa akin.

42. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

43. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

44. Huwag daw niyang papansinin si Ogor.

45. I forgot your birthday, but here's a card anyway. Better late than never, right?

46. Eine hohe Inflation kann das Wirtschaftswachstum verlangsamen oder stoppen.

47. Stay there. si Maico sa awtoritadong tono.

48. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

49. Oo. Pero kelangan.. susunod ka lang sa akin, ok ba yun?

50. Naghihirap na ang mga tao.

Recent Searches

dietsinimulanlapitannasabingkasingtigascelularessuccesschildrenblusanghouseipatuloydangerouswalongtapemalalimngangnagniningningmuntingsumunodmaawaingbellkumarimotcomemacadamiainalisnalasingnuclearoftematchingnilangchadpedrohimutokskillhellodecreaseinspiredprovidedaggressionipihitestablishedrobertkiloexpectationseksamkatagangcapitalistlihimutilizarmatikmanmagbabakasyonshinestalaganglarawanpumupuntaliv,roquebandangdeathpunohanap-buhaynakapagsabikamaymasukolcorrectingpamahalaanjobbranchesmarurumibumagsakmaisginawaranculturasgubatsipaggamespamilyanakikini-kinitasalitanginterestkundimanbridetiempostawananshevideobalitapeer-to-peeractorsagasaanbulaklakhealthsubalitbutilnatuwabukodcualquiersanggolmagsungitcountrynapakabilismagdamagsagutinpeksmangiyeraenviarpartsumiisodmagtakanapatigilmayabongnakatitigsiksikanyumuyukoyumabanglumibotpookexcuseglobalrestawandatapwatirogrobotictensumasambapumuntahamaksobramalagoexamipagbiliabalaleytelargerbosssystematiskleonagtrabahopagpasensyahanhinipan-hipanmerlindananghahapdinaglalatangnagmungkahiikinakagalitmagpa-checkupanibersaryopinagpatuloymagpa-picturenagliliwanagikinagagalaktwitchbasketballtatayonag-ugatkumaliwamakalipaslumikhanagpabotnapanoodmaliksiturismodadalawinumiiyaknapakagagandaeconomykuwartohumahangosdumagundongnapatawagmagpalibrehubad-baroeverythingkumitanaiilangricamakasalananglandlinemahinakalakisinaliksikkumilospilipinaspagkaangatnamatayleadersnaliwanagannareklamomakabilihanginmananakawnagbantaykatuwaanmagsusuotnandayapaliparinkapwamahahawagagamitliberty