Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

2. Ano ang nasa kanan ng bahay?

3. Wag kang tumabi sakin! paguutos nito.

4. Nang malapit nang magdilim, kumaripas na ang mga magsasaka pauwi sa kanilang tahanan.

5. Paglalayag sa malawak na dagat,

6. Det er vigtigt at skabe en inkluderende og støttende samfund for transkønnede personer og bekæmpe diskrimination og intolerance.

7. Magandang-maganda ang pelikula.

8. Nakaramdam siya ng pagkainis.

9. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

10. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

11. Comer una dieta equilibrada puede aumentar los niveles de energía y mejorar el estado de ánimo.

12. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

13. Tuwang tuwa siya sa mga palaka, para sa kanya ay nakakaakit ang mga malalaki at bilugang mata ng mga ito.

14. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

15. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

16. Nakasuot siya ng maluwag na damit para hindi lumala ang bungang-araw.

17. Ang snob naman neto. Alam mo ba kung anong oras na?

18. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

19. They have studied English for five years.

20. Magsabi ka ng totoo, kung di ay dadalhin kita.

21. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

22. ¿Dónde está el baño?

23. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

24. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

25. Mataman niyang inisip kung may iba pang nakakita sa nangyari.

26. Masarap higupin ang mainit na tsokolate sa malamig na gabi.

27. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

28. Ang banal na kumbento ang naging tahanan ng mga sakristan.

29. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

30. The eggs are beaten until the yolks and whites are well combined.

31. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

32. The bride looked stunning in her wedding dress, truly a beautiful lady.

33. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

34. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

35. The chef is not cooking in the restaurant kitchen tonight.

36. Ano ang palitan ng dolyar sa peso?

37. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

38. Para sa kaibigan niyang si Angela

39. The Flash can move at superhuman speed, making him the fastest man alive.

40. Natutuwa ako sa pag-aalaga ng mga halaman kaya nahuhumaling ako sa pagtatanim.

41. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

42. Kapag may isinuksok, may madudukot.

43. Ang nababakas niya'y paghanga.

44. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

45. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

46. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

47. Mabilis na tumatakbo ang kotse papunta sa kaniyang opisina.

48. Kelahiran di Indonesia biasanya dianggap sebagai momen yang sangat penting dan bahagia.

49. The objective of football is to score goals by kicking the ball into the opposing team's net.

50. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

Recent Searches

magbungabossnetflixmatangumpaydietlumipatinternacionalkapataganpeppypaglalayagnakakasamadecisionspoorero-onlinetabasmagulayawinvitationinirapanminatamistermbinge-watchingpagpapakilalaalaalanaglaontsuperdebatesaalispakelambinabalikgabemapaikottaleminamasdanipinalutonanghahapdisyascottishrewardingpagtatanimmakakuhadapit-haponsiguronagkasunogsumarapinimbitaeachutak-biyacontrolarlastagalogalininformednagpakunotbilugangalingliboaidsourceslcdpagpasensyahandoingkumembut-kembotkakayananganywherediyospaumanhinpagtatapossikiplumikhaentoncesfieldlaki-lakipangyayaringoverviewcanadatokyohinugotnagtrabahounti-untingedit:magkasabaymakuhadagatunahinreserbasyonnakasakitfoundpagsasalitaideologiesnagpapaitimbulaklakilansumapitpananakotkinabubuhayhealthierpinilitsasakyanmahuhulimatatageventosvocalinulitcitizensmaibalikasoyancakelegislativemaliwanagsenadorgalinglandasestarendsabayshoesligaligcrushleukemiakayangparticularnoongomeletteofferincidencekalawakankababalaghangmailappawisbahayculturaskoreanatabunannalalabingmejomakabangonjeepneynitongelevatorkayonagagamitbaboybeingsnatressalattelevisionsangagreenkampanaenergy-coalpinagmasdantinanongnathanpreviouslydadisinalangsakristansaginghojasmagpakasalinabotmaipapamanalumulusobnagdadasalresourcesnapapahintosambitpuwedemonetizingumiibigrecentdumilimmarangyangzoovidenskabgratificante,pakikipagtagpokonsyertopinagalitankuwadernogirlhospitaldividedlegacytanawinpagsigawhighkantomapahamakabotresultcitenagbiyayasisipainnamulaklakeducationaloftehinawakanancestrales