Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

2. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

3. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

4. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

5. I have seen that movie before.

6. Sumagot agad si Kuya isang ring pa lang.

7. Risk tolerance is an important factor to consider when deciding how to invest.

8. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

9. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

10. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

11. Magandang umaga po. ani Maico.

12. He is taking a walk in the park.

13. Hindi ko na kayang panindigan ang aking pagkatao dahil sa inis na nararamdaman ko.

14. Kasya kay Suzette ang blusang na ito.

15. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

16. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

17. Hanggang ngayon, si Hidilyn Diaz ay patuloy na nagsasanay at sumusuporta sa mga atletang nangangarap tulad niya.

18. Pendidikan agama merupakan bagian integral dalam kurikulum pendidikan di Indonesia, memungkinkan generasi muda untuk memahami dan menghargai agama-agama yang berbeda.

19. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

20. Shaquille O'Neal was a dominant center known for his size and strength.

21. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

22. Okay.. sige.. intyain ko na lang tawag niya.. thanks..

23. Kasingtigas ng loob ni Sultan Barabas.

24. I know they're offering free samples, but there's no such thing as a free lunch.

25. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

26. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

27. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

28. Ang tulang ito ay may petsang 11 Hulyo 1973.

29. Siya nama'y maglalabing-anim na.

30. Sira ka talaga.. matulog ka na.

31. The traffic signal turned green, but the car in front of me didn't move.

32. Kumanan kayo po sa Masaya street.

33. The website's contact page has a form that users can fill out to get in touch with the team.

34. Dogs can be trained for a variety of tasks, such as therapy and service animals.

35. Ano ang ginugunita sa Thanksgiving Day?

36. Tahimik ang buong bahay, waring walang tao sa loob.

37. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

38. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

39. Ang punong-kahoy ay nagbibigay ng sapat na lilim para sa mga nilalang na nabubuhay sa ilalim nito.

40. Cutting corners in your exercise routine can lead to injuries or poor results.

41. Andre helte er stille helte, der arbejder i skyggerne.

42. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

43. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

44. The model on the runway was a beautiful lady who effortlessly commanded attention.

45. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

46. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

47. Gusto ko ang silid na may malaking bintana para maaliwalas ang pakiramdam.

48. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

49. Sana po ay maibalik ko pa ang panahon upang mabigyan sila ng kasiyahan.

50. Two heads are better than one.

Recent Searches

dietbarrocoamorawkaharianfeelmakulongisamalaboeasierroboticeeeehhhhthenduriuncheckedleukemiasoredebatesbinabacrazybeginningibabarosariostudenttvsprogresstransparentmalimitgawanerrors,pamburaemphasizedexistmanagerdumaramilearnryanventamultopinagpatuloysacrificemakapagpigilguerreronaglahongbilanggonakaakmagayunpamanmataloaustraliaexpertisepresidentemasikmuradaddynagbanggaannakagalawibinentanakatirangiwanantumakasmusiciansbunutanmiyerkoleshusopagdiriwangtaonsementonghuertobarriersbatokpersonngumingisitulogmabibingischoolkakaininfestivalshowsrefnakatapatnatatawacomunesmawalanakahugboybulakpepetinioginisingthanksdetexpertmahiwaganamungaspeechnowbinibilangsocialesusarektanggulopundidoguiltypagresorttakotnagtalagahiganteanimomagitingtanongpagsasayayumuyukonaghihirapressourcernegulomoneyipagmalaakinatingalama-buhayginagawamalakiexampleelectronicbakitsinasabimanananggalipipilitnahintakutankelanakintanganhappylumagomiraefficientparusahanfoundapoyrestaurantinternajackzgabeworkshoppakidalhannai-dialfundrisehumalomagkasamakinalilibinganmakakibomakuhangfilipinananlalamiglumakilandlinenakakaindisfrutarbalenangampanyanamumulaklaknakikilalangespecializadaspinakamaartengpagawainlolapagtatanimpupuntahanatensyonghouseholdshumahangosmakangitierlindakapamilyamagpaniwalanagkakasyamaghihintaypakinabangantig-bebeintenagdalastoryberegningernanunurisenadoribinaonkatolisismonakalocknasasabihanakmangnagtapossangadamdamintindahantanyagrespektivenaawasugatanghawakkinapanayamkeepingnagdiriwangincreasingly