Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

5. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

6. Eating a balanced diet can increase energy levels and improve mood.

7. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

8. I'm on a diet, but I couldn't resist having a small slice of cake.

9. I've been following the diet plan for a week, and so far so good.

10. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

11. Meal planning and preparation in advance can help maintain a healthy diet.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Portion control is important for maintaining a healthy diet.

14. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

15. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

16. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

2. Seperti makan buah simalakama.

3. She always submits her assignments early because she knows the early bird gets the worm.

4. Saan ka galing? Dalawang araw na ako dito ah! aniya.

5. Palmesøndag er den første dag i Holy Week og markerer Jesu triumfmodtagelse i Jerusalem.

6. Tumututol ako sa kanilang plano dahil alam kong may mas magandang paraan para matupad ang layunin nito.

7. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

8. Wala akong pakelam! Dapat sayo pinapalo!

9. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

10. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

11. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

12. Nanlilimahid ang mga bata sa daan.

13. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

14. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

15. Eeeehhhh! nagmamaktol pa ring sabi niya.

16. The professional athlete signed a hefty contract with the team.

17. Pupunta kami sa Laguna sa makalawa.

18. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

19. Banyak jalan menuju Roma.

20. Hindi ko ho makain dahil napakaalat.

21. Sa halip na umalis ay lalong lumapit ang bata.

22. Mahalagang magkaroon ng regular na dental check-up upang maagapan ang mga problema sa ngipin.

23. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

24. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

25. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

26. Mas matangkad ako kaysa sa kanya.

27. Lagi tayong gumawa ng mabuti sa ating kapwa lalo na sa ating mga magulang.

28. "A dog is the only thing on earth that loves you more than he loves himself."

29. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

30. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

31. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

32. O-order na ako. sabi ko sa kanya.

33. Umiling ako, Wala naman. Akala ko kasi kakilala mo sya,

34. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

35. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

36. Kumalas ako sa pagkakayakap niya sa akin.

37. Bite the bullet

38. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

39. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

40. El arte puede ser utilizado para transmitir emociones y mensajes.

41. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

42. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

43. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

44. She does not use her phone while driving.

45. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

46. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

47. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

48. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

49. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

50. ¿Me puedes explicar esto?

Recent Searches

dietnakatunghayhapagsumusunodstrategycontinuedsakalingmaramdamannakikiabumagsaknag-aaralbusinessesoveradditionallyumagakakayanangpagka-diwataabriltalagangugatreaderssamakatuwidupangbornbalewritingnakaraanitsuratonightpapapuntasabixixnowmasyadolugawownapelyidoparatinghanapbuhayfallmaskinaghinalabrasopagdidilimsilyaawapagsusulitbulaklakcharismaticanadaddycompostkandidatofrednaintindihanmamanhikanworkdaydisciplinwealthngitinaglipanangika-12chunosakaiginawadamoyalintuntuninbigaylibertyhiramkampointeriormabagalsalbahengpakibigaykumpletomakainnakapilacardlovepilitibotoipinahamaktinginnagliliwanagrichtagalerhvervslivetusingnitomanananggalkamoteopisinatuloy-tuloymaramilabankondisyontanyagspeechessana-allotherpagsilbihantuladgenerabamakapaniwalamagagalingkakauntogbangputinganimlayawpublishedhihigitnagngingit-ngitnagbibigayanbook,presentgenerositynodmamimilihumanapnakapagngangalitparangothersprobinsiyavegasnakangisigagamitpanibagongayudataasitinulosmisaloobisasagotpakiramdammentalpinaghatidannapatawaggusalishortnagwalishimihiyawipagtatapatmonitoripinatawagnakapayongcomputerabstainingpagkaimpaktonapakabagalmag-plantbilinbasahinconditionhiyapatuyokumalatnaghanapbumisitaforskel,ingaygawainpandemyabutasdingcramehongshoppingevolucionadolarawanjolibeenicoinspiredbinigaymachinessumibolwalang-tiyakencuestasmangpopulationkaklasestreetonebumangontamaantinurotig-bebeintekindleactingtilaidaraanincreaseddeterminasyonbigdonsooncreatepondocorporation