Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. The police were trying to determine the culprit behind the burglary.

2. Napatingin ako sa may likod ko.

3. El algodón es un cultivo importante en muchos países africanos.

4. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

5. Emphasis is an important tool in public speaking and effective communication.

6. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

7. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

8. Maaliwalas ang panahon kaya itinuloy namin ang piknik.

9. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

10. Tumango tapos nag punta na kami sa may garden ng hospital.

11. Mi temperatura es alta. (My temperature is high.)

12. Quería agradecerte por tu apoyo incondicional.

13. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

14. Mange små og mellemstore virksomheder i Danmark eksporterer varer og tjenester.

15. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

16. Hindi dapat tayo sumuko sa agaw-buhay na laban sa kahirapan.

17. Time heals all wounds.

18. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

19. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

20. Sa Chinese New Year, ang mga tao ay nagpapakasaya at nagdiriwang ng malakas.

21. Beauty? tanong pa ni Mrs. Lacsamana.

22. At forfølge vores drømme kan kræve mod og beslutsomhed.

23. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

24. Makikita ko si Mrs. Santos bukas.

25. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

26. Uncertainty can create opportunities for growth and development.

27. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

28. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

29. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

30.

31. It’s risky to eat raw seafood if it’s not prepared properly.

32. Women make up roughly half of the world's population.

33. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

34. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

35. Mi amigo del colegio se convirtió en un abogado exitoso.

36. Ang galing nya magpaliwanag.

37. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

38. Hindi dapat natin kalimutan ang ating mga responsibilidad, datapapwat ay may mga pagkakataon na napapabayaan natin ito.

39. Pati ang mga batang naroon.

40. Nakatira si Nerissa sa Long Island.

41. Ein frohes neues Jahr! - Happy New Year!

42. Ang magnanakaw ay nagtago sa isang madilim na eskinita matapos ang kanyang krimen.

43. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

44. Sorry, I didn't catch your name. May I know it again?

45. May mga punong-kahoy na nagiging sentro ng mga turista dahil sa kanilang napakalaking sukat at ganda.

46. Guten Abend! - Good evening!

47. The stock market is a platform for buying and selling shares of publicly traded companies.

48. The pretty lady walking down the street caught my attention.

49. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

50. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

Recent Searches

pisonapatingalahousemakaratingdietbotantepresyopetsayesgreenlarryanimoreservationtungopusoumingitsumusunolatebinabalikelitedettemodernbrideeksenavedcharminginalisagilityjeepkalakingfredsingerkasinggandachecksjoyhoweverbornkababayanstringlargeberkeleyreadingsummitsambitanimnasasubalitvistfurtaga-nayoncriticstinamaanbilanggonapapansinsupilinenergycarbonpasokpagkabiglamagtipidabundantepinakamaartengpagtiisanhalu-halomaglalakadkelannakaraanupworkmagbalikpaglingonhumabianiyahandaantinginkaawaynakiramaymalayogeologi,sellpagkasabibusiness,pagsisisibibilinandayabatangmamanhikanhigantebiyayangnagmamaktolproducerermagpakasalrinkawili-wilibingitoyenergipakikipaglabanbrucelumakicultivationpasinghalpeterlarangankumustaelectedseriousisipkainpangingimiradionumerosasnakapuntamournedtransmitidaspangitinaeffektivsigapagbabagong-anyodonmagbagong-anyonakakaensmokingenergy-coalrangeminerviebinentahanmahabolganapintagpiangsukatinpapayaproducetrentanaiiritangpaninigaslansangannakabluepangalananbasketballpaliparinnaawanakabaonkastilalumiitgalaanpadalassumalakaybarrerascynthiaemocioneskatuwaannakapagsabipaghalakhaknapakahusayt-shirtmagkaibamagkakagustokumbinsihinfotoskwenta-kwentanapakatagalnagbakasyonhampaslupalikelyiintayinmag-inamahiwagangsaritagagawinnakalagayumiiyakpagtatanongnagsagawapinapasayapag-unladnakikitangpinagawamahinogkabutihansharmainemalapalasyonananalongnapanoodkanikanilangpaglapastanganminamahalkapasyahannakapaglaronakasahodinilistaintensidadyouthsundalokondisyonitinatapatmagbantaynecesariokidkirannakakamit