Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Hay muchas hojas en el jardín después de la tormenta.

2. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

3. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

4. Nangagsibili kami ng mga damit.

5. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

6. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

7. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

8. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

9. Ang panayam sa radyo ay ukol kay Doktor Jose Rizal na tumulong sa mahihirap.

10. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

11. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

12. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

13. Sumasakit na naman ang aking ngipin.

14. Naging inspirasyon si Mabini para sa maraming Pilipino na maglingkod sa bayan.

15. Cut to the chase

16. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

17. Isang mahigpit na tunggalian ang naganap sa gitna ng kabanata, na nagbigay daan sa pagbabago ng landasin ng kuwento.

18. Masyadong advanced ang teknolohiya ng bansang Japan kung ikukumpara sa ibang bansa.

19. Hindi dapat pagbasehan ang pagkatao ng isang tao sa kababawang mga bagay tulad ng panlabas na anyo.

20. Den danske økonomi er bygget på en kombination af markedsekonomi og offentlig regulering

21. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

22. Okay na ako, pero masakit pa rin.

23. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

24.

25. When we forgive, we open ourselves up to the possibility of reconciliation and rebuilding damaged relationships.

26. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

27. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

28. Sino ang puwede sa Lunes ng gabi?

29. Opo. Magkapareho po ba ang disenyo?

30. Lumipad ang binatang naging kulisap upang hanapin ang babaeng mas maganda pa kaysa sa engkantada.

31. Sinubukan kong gumawa ng kakanin gamit ang pulotgata, ngunit hindi ko nagustuhan ang lasa.

32. To infinity and beyond! at binaba ko ulit yung telepono.

33. Sa isang linggo ay pupunta kami sa Japan.

34. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

35. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

36. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

37. Halos wala na itong makain dahil sa lockdown.

38. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

39. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

40. Don't cry over spilt milk

41. Jacky! magkasabay na sabi nung dalawa.

42. Ang pagbisita sa magagandang tanawin ng Pilipinas ay ikinagagalak ng mga turista.

43. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

44. Pumunta kami sa may bar ng bahay nila.

45. Walang huling biyahe sa mangingibig

46. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

47. The community admires the volunteer efforts of local organizations.

48. Endelig er Danmark også kendt for sin høje grad af økologisk bæredygtighed

49. Wives can be loving, supportive, and caring companions to their spouses.

50. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

Recent Searches

dietbusogwellflavioisinalaysaykumukuhataxinararamdamanbastatinaasanumaagosnagtataeakintaglagaswaysespigasotrasconvertidasbulakgananilalangnabigayislandpaghabajunesangkahariandalawnamungayumaogamemaibigaysinedaratingmakalipasnaabottumigilsumakaykumaenplayednapawitsakanilolokobingonababakasiniirogexpertpinakamaartengmesangiikotnagtalagaestablishedintindihinguerrerosiyudadmanyuniversitiesclassmateprogrammingefficientaudio-visuallybasaproperlynalugmokworkshopgenerabaerrors,hapdidesarrollaronutak-biyapreviouslymacadamianagbagohelloeksamisulattransmitspumikitnagwagimagsabiihahatidpaghangasikonaghihinagpisailmentsmakakabalikpagdiriwangjoshuamagdaanmississippipinalutocubicleginisingbroadcastingseparationpresentspeechexpertiseoxygenmagtiisaktibistanapaplastikanlalaexcusenanoodnakahigangnapatungotagalogkalankrusmalihisawaresumugodpagguhitabangankanaglobediapergeneratednapatawagdiplomanagmamadaliganyannalalaglaghugisnatakothotdogmonumentotalentkanilamatamankinapanayamproducts:bentangdalawintrinapinakamasayapitakanaiiniscompostelasalitangvigtigstedidingmahigitnagbigayanpagluluksasakristanstoplightnaliwanagandisposaltravelmasdantungomaistorbouminomsoundsumapitmagalingbigongpasigawmoderndawreserbasyonhealthiersisikatannasikre,kakuwentuhanmagbibiyahelimitedmarketplaceskatawangculturasmateryaleshospitalmalezainvestingofferkasamaangkamalianasiaticmaranasanamongyarimabutipinahalatalayawbilanginnakatigilnatigilanpagpapasanbusabusinkatabingvictoriabritishisinusuotdiferentestokyotumahimikfame