Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

2. Taksi ang sasakyan ko papuntang airport.

3. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

4. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

5. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

6. Madalas ang anak pa ang nagagalit kapag ang pagkaing maibigan ay hindi agad maibigay.

7. Alangan ako?! Ako na nga unang nagbigay eh! Ikaw naman!

8. Alt i alt er den danske økonomi kendt for sin høje grad af velstand og velfærd, og dette skyldes en kombination af markedsøkonomi og offentlig regulering, eksport, offentlig velfærd og økologisk bæredygtighed

9. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

10. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

11. Nasa likuran lamang niya ang nagsalita.

12. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

13. Hugis katawan ng nakahigang babae ang bundok makiling.

14. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

15. No tengo apetito. (I have no appetite.)

16. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

17. Natatanaw na niya ngayon ang gripo.

18. Scientific research has led to the development of life-saving medical treatments and technologies.

19. El invierno se caracteriza por temperaturas frías y, a menudo, por nevadas.

20. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

21. Medyo napalakas ang pag kakauntog nya sa pader.

22. Det er en vigtig del af vores moderne liv, og det har haft en stor indvirkning på måden, vi lever, arbejder og kommunikerer på

23. Ang ganda naman nya, sana-all!

24. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

25. Sunud-sunod na nakatalungko ang mga ito sa isa pang bangkong nas atagiliran ng nanggigimalmal na mesang kainan.

26. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

27. He has been working on the computer for hours.

28. Gusto mo talagang maputulan ng card? pagbabanta ni Maico.

29. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

30. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

31. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

32. Hinugot ko ang papel sa loob ng envelope.

33. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

34. Maiba ako Ikaw, saan ka magpa-Pasko?

35. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

36. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

37. Mayroon nang natanggap na impormasyon ang pulisya tungkol sa pagkakakilanlan ng salarin.

38. Saan nyo balak mag honeymoon?

39. Cancer can impact individuals of all ages, races, and genders.

40. Pinanood namin ang Ifugao kahapon.

41. Nagtatampo na ako sa iyo.

42. Limitations can be addressed through education, advocacy, and policy changes.

43. "Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan" ay isang bukambibig na nagpapaalala na mahalaga ang pag-alala at pagpahalaga sa mga pinagmulan.

44. AI algorithms are computer programs designed to simulate intelligent behavior.

45. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

46. Ang paglalakad sa kalikasan at pakikisalamuha sa kalikasan ay nakagagamot sa aking isip at katawan.

47. Ano ang ikinagalit ng mga katutubo?

48. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

49. Maraming bagay ang kailangan isaalang-alang sa pagpaplano ng kasal, tulad ng budget at mga bisita.

50. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

Recent Searches

dietsalatginawaranvarioussetpagkatakotagostomainstreamjunjunmaglalakadmagnakawvideos,pagpapakilalanalulungkotmakikipag-duetopakikipagtagpobiocombustiblesagwadormalambotnakalilipasnagkasunogibinubulongsabadongnaka-smirkhila-agawanmalezaespecializadascourtdurantekabuntisankubyertosrebolusyonmangkukulambumisitanagnakawpaglalabadalimosnaglipanangdoble-karanakakamitencuestasuugod-ugodkabutihannakapasaproductividadnamataycomonaulinigantumatanglawngumingisiwatawato-onlinenagsmilekidkiranngumiwihayaangnalalabingmahiyarawmaghihintaykumanantumatawadkuripotbumaligtadlot,temperaturaculturasintindihinmagpakaramiiligtasisasamaiyamotmatagumpaylumipadsugatanggawainkristopasigawlimatiklulusogmanonoodmahigitgustongsanaymabibinginanigaschristmasrimasikatlongasukalkinantakasalpersonnatitirapakakasalannapapatinginflamencokaniyaasawakakaibangperseverance,coughingnabighanininongdefinitivosundaekontingtelefonpresleyninyotinikpamanhikanpinakawalandaladalanakatingingditotumangoindiakatedralpadabogeducationgoalmejodreambarrocolettergivehojasxixmakasarilingnapatingalatwitchcesbowsuelomaluwagritwalmegetdilimipagamotsearchroomkerbsellpinangaralanmaghandanabubuhaymulifacilitatingetodividesstonehamcongratsmainitofferhelpfulinteriorthemcreationtalecrazyrelativelyevenfredreadingstringdevelopmentrequireleadskillknowstartedberkeleypagkalitokawili-wilimalayainaaminharisystematiskpagkakahiwawalislabingparaangderespanunuksobinatangdawmaynilamagkaparehotinapaydalawa11pmgreenpagka-datutelevisednakatitigprovidedunangkagipitaninterest