Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

2. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

3. Kapag niluluto ni Tatay ang adobo, ang amoy ay sobrang mabango at nakakagutom.

4. Nakikita mo ba si Athena ngayon?

5. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

6. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

7. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

8. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

9. En ren samvittighed kan give os en følelse af ro og tilfredshed.

10. Beast... sabi ko sa paos na boses.

11. Guilty. simpleng sabi niya saka ngumiti ng malapad.

12. Siya ho at wala nang iba.

13. I am listening to music on my headphones.

14. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

15. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

16. Sa panahon ngayon, maraming tao ang nag-aagawan ng agaw-buhay na pagkakataon sa trabaho.

17. Haha! Bad mood na bad mood ka ah?

18. Ngumiti muna siya sa akin saka sumagot.

19. Si Teacher Jena ay napakaganda.

20. Bumibili ako ng malaking pitaka.

21. Las hojas de los cactus son muy resistentes y difíciles de cortar.

22. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

23. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

24. Hindi ko matatanggap ang kanilang panukala dahil mayroon akong mga reservations dito.

25. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

26. Paano po ninyo gustong magbayad?

27. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

28. Translation: I cannot change the past, I can only accept it with "what will be, will be."

29. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

30. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan kemauan untuk beradaptasi.

31. Mahilig sa paglilinis si Susan kaya't hindi siya nag-aalala kapag kailangan niyang maglaba ng malalaking bagay.

32. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

33. Makikita ko si Mrs. Santos bukas.

34. In conclusion, the telephone is one of the most important inventions in human history

35. The widespread use of the telephone has had a profound impact on society

36. Limitations can be frustrating and may cause feelings of disappointment and failure.

37. Napatungo ako dahil nangingilid na naman ang mata ko.

38. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

39. He has been practicing basketball for hours.

40. Hindi rin dapat supilin ang kalayaan ng mga mamamayan na magpahayag ng kanilang opinyon.

41. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

42. For you never shut your eye

43. The website's online store has a great selection of products at affordable prices.

44. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

45. The telephone has also had an impact on entertainment

46. Wala ho akong kinukuha sa inyong pitaka.

47. Det er vigtigt at give børn en kærlig og støttende opvækst.

48. Sa kaibuturan ng aking damdamin, mahal ko siya.

49. Susunduin ni Nena si Maria sa school.

50. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

Recent Searches

piecesdietxixsufferipagamotoliviaitakexperiencessumapitlegislativefaultsimplengeffectsmakalaglag-pantymakatatlouugud-ugodnaibibigaypinamalagihitahumahangospinapasayamahahanaysakristanpaghihingalosimonnagtitindamedya-agwagayunmannagpakitagayunpamanculturadistansyasikodraybersangaoutlineunangdisenyongnagsasagotnaguguluhangmatapobrengtobaccosalamangkerofilmsikre,nagulatkinauupuangbayawaknaglahokulunganmananaloumiinommagtataaspagdudugomakasalanangmagkakaroongumagamitmahiwaganahahalinhanhahahahagdananinilabasmusicalespumayagnapatulalasaan-saanpamagatpanindaimprovenakisakayrewardingpapalapitculturessilid-aralanmahabolsugatangbusiness:nagtapostiyakpagsahodnakapikitlilipadisubobanalisinamatsinainspirationtalinopaliparinmatandangnuevosmariebulongbumangonbarangaysisipainnatitirapakainintataascurtainsganyanahhhhaddictioncarriesmatayoghangintsuperkirotforskelmusicianssmilebaryosellingelectorallivesbagaykarangalaniskedyulcnicomaingattrajeinalagaanlistahaniikligoodeveningmapahamakfamecassandraiyanumaagoshugishinoganywhereairconeffektivpeaceresignationpinatidbagyobilaoiniinombiglasnasuccessmayroonsumabogeffortscryptocurrency:katabinglegendsnahulimedievalminutotoothbrushreservesbabesnami-missbugtongscientist10thmalinismajorcardcallernagbungasoreunderholderbaulpumikitkasiyahanhinamonmapakalifriespedepaastevetekstnathanpooksinongfatsaringeksenaochandowaysbitawanconectanvasquestargetborndidgracehomeworkiosbahayparanghumingasecarseimprovedrelieved