Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

2. Isang araw, umuwing mainit ang ulo ng binatilyong apo dahil natalo sa sugal.

3. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

4. Ano ang ginagawa niya sa gabi?)

5. El parto es un proceso natural y hermoso.

6. ¿Puede hablar más despacio por favor?

7. Bata pa lang si Tony nang iwan sya ng kanyang ama

8. Ang biglang pagtawag ng alarm ay binulabog ang katahimikan ng gabi.

9. She admires the bravery of activists who fight for social justice.

10. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

11. Marahil ay nasa kabilang dako ng mundo ang taong mahal mo kaya't hindi kayo nagkikita.

12. Satu titik hitam bisa merusak noda yang putih.

13.

14. Huwag po, maawa po kayo sa akin

15. Nagmungkahi ang dentista na ipalinis ko na ang aking ngipin.

16. Los padres pueden prepararse para el nacimiento tomando clases de parto y leyendo sobre el proceso del parto.

17. Kailangan natin ng mga kubyertos para makakain ng maayos.

18. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

19. Huwag magpabaya sa pagsunod sa mga patakaran at regulasyon sa trabaho.

20. Format your book: Once your book is finalized, it's time to format it for publication

21. Ang poot ang nagpapagana sa aking determinasyon na magtagumpay at patunayan ang aking sarili.

22. Sweet foods are often associated with desserts, such as cakes and pastries.

23. Ang pagpapakalbo ng kagubatan ay isa sa mga pangunahing dahilan kung bakit nagkakaroon ng pagkawala ng mga punong-kahoy.

24. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

25. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

26. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

27. Ipaghanda mo si Lina ng Maghanda ka ng damit

28. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

29. Ako ay nagtatanim ng mga halaman sa aking bakuran.

30. You got it all You got it all You got it all

31. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

32. Ang aking kamalayan sa kultura at tradisyon ng aking bansa ay nagpapalalim sa aking pag-unawa sa aking mga ninuno.

33. Hi, we haven't been properly introduced. May I know your name?

34. The information might be outdated, so take it with a grain of salt and check for more recent sources.

35. Nabasa niya ang isang libro at matapos niyang basahin, naglimot na agad siya sa mga pangunahing detalye ng kwento.

36. The dog does not like to take baths.

37. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

38. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

39. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

40. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

41. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

42. The Twitter Explore tab provides a curated feed of trending topics, moments, and recommended accounts.

43. May problema ba? nagtatakang tanong ni Maico.

44. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

45. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

46. Ngumiti siya sa akin saka nagsalita.

47. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

48. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

49. Ang India ay napakalaking bansa.

50. Naku! Hindi pede, hindi akin yan eh. eh kay Chad yun eh.

Recent Searches

dietganakristoprocesomegetnahulisellhigitshowslivespashapinggoodsumakitdaangdaigdigpagbatiderinspirasyonpracticadobroadpapuntabumagsaklastingdecisionscreationslavefencingparatingsquatterinspiredmedikaldumaramimanagerwhichryanmuchreleaseddecreaseworkshopconvertingbinilingclockibonnakagawianlungsodbridebahakalaunanpakanta-kantataosanlabomovieyaribilibidbitbitlarrynagpalalimmonitortraditionallutuinisdapapuntangsalamangkeropinakamatapatnakaluhodmagkasintahannakikilalangguhitsuccesscapitalmrsgenerabatiketmanggagalingbasuraputahewalangpinagwagihangstudenteasierproduciralingbinabalikumaalisniyaipinahamakabotfutureipinalitpatricklargekasingclosestructuremanghuliabangantinulak-tulakunibersidadmakapaibabawoktubreniyonnagkalapitnagreklamomanghikayatpamilyangnagpepekebusilakdistancia1940filmmonsignorhila-agawanmeriendakapangyarihansomethingdonemaawakasamaangcruziniuwipahabolhiganteculturebayawakdeliciosanalugmokpagpanhiksapattutungonaiilangnauliniganpinasalamatanavanceredeikukumparananonoodcultivationnaglaronagbentabwahahahahahamaluwangkalabanbighanitanghalimahahawanabigkassisentasementowakaspagiisipnaglabaasawaabutanjagiyarepublicankaragatannilaoseneroself-defensekinakaysadustpankinabukasannakikini-kinitacarloaddictionkahusayanbagkussisidlanumiinomkontingcnicosumisilippublicationmabaitreplacedginawaranhomeshundrediskedyulvisttuvofarmfriendsstomangingisdaindiataasmananakawtumulongnilaestablishginangpedrorabeteleviewingmaalogpagbahingpumuntagabe