Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Saan ka kumuha ng ipinamili mo niyan, Nanay?

2. La película que vimos anoche fue una obra sublime del cine de autor.

3. Es importante trabajar juntos para abordar la pobreza y promover un mundo más justo y equitativo.

4. The dog barks at the mailman.

5. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

6. Tantanan mo ako sa legend legend na yan! hahaha!

7. May I know your name so we can start off on the right foot?

8. Pakibigay ng tamang direksyon sa mga bisita upang hindi sila maligaw.

9.

10. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

11. En invierno, los deportes en el hielo como el hockey sobre hielo y la patinaje sobre hielo son muy populares.

12. This shows how dangerous the habit of smoking cigarettes is

13. Sana maintindihan mo kung bakit ako nagagalit at nag-iinis sa iyo.

14. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

15. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

16. Pumupunta siya sa Maynila bawat buwan.

17. Nanood sina Pedro ng sine kahapon.

18. Technology has also played a vital role in the field of education

19. Nagpa-photocopy ng lumang diyaryo

20. The flowers are blooming in the garden.

21. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

22. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

23. The cat was sick, and therefore we had to take it to the vet.

24. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

25. Ang nakakalungkot na balita ay nagdulot ng malalim na naghihinagpis sa buong komunidad.

26. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

27. Amazon is an American multinational technology company.

28. Gusto mong makatipid? Kung gayon, iwasan mong gumastos sa mga di-kailangang bagay.

29. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

30. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

31. Mabait siya at nanggagamot siya nang libre.

32. Una mala conciencia puede llevarnos a tomar malas decisiones.

33. Gracias por tu amabilidad y generosidad.

34. Palaging nagtatampo si Arthur.

35. Ang sinabi ng Dakilang Lumikha ay natupad.

36. Iniuwi ni Rabona ang pusang iyon.

37. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

38. If you quit your job in anger, you might burn bridges with your employer and coworkers.

39. Gusto ng mga batang maglaro sa parke.

40. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

41. Sumimangot siya bigla. Hinde ako magpapapagod.. Pramis.

42. Nagbenta ng karne si Mang Jose kay Katie.

43. La historia del arte abarca miles de años y se extiende por todo el mundo.

44. Nang bumukas ang kurtina, lumiwanag ang entablado.

45. Saan mo dinala ang dinukot mo sa aling ito?

46. Amazon's Kindle e-reader is a popular device for reading e-books.

47. Madami talagang pulitiko ang kurakot.

48. My sister gave me a thoughtful birthday card.

49. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

50. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

Recent Searches

dietkamalianencompasseshehefar-reachingguardanapilingefficientmasdanpagkakahiwaclientspiecesmakapilingtopicnaiyakwaitevolvetabatoolcharmingpasokfreelancerpinaghatidanpahahanapnaglakadunahinmemorialnapakagagandanagkwentopalabuy-laboypaga-alalabibilhinpagkakalutopaketesakupinsasapakinnuevosdescargarmusicalalangankatolisismomaglaroprincipalessay,lolapoongmatagumpaynaguusapmatumalnabigyanmalalakiartistasarongbibigyanmakatirequierentusongtengapnilitbumangonomfattendeannikasalbahepa-dayagonalpakisabimaisiphastagaanogigisingenergysumimangotnumerosaslasabumuhospagsambagymmasarapantokpalakatabituladdalagangplasakumatoksinipangspent10thloansremainpatipaskosumarapkanto178711pmmeaningabeneproporcionarasinwordsmagazinessinagotnagpetsangyouthpinggansobrasponsorships,chavitmitigatepedrodisappointimpactedmaubosumilingpalantandaanbotedancedoonkasamaanghonestodividesdinalawlabananferrerluisneedsdinminamasdannagbentapagbahingwaystipidkadalasnagtatanimboksinglumabasjingjingyelotumahimiksharkmanahimiksabihingpag-aanilangsilacanadamurangkwebavehiclesbarcelonaattractivepicstumatakbonegativepeterupworksikodatapwatinisalaminternatumiraimprovedtelefonmahusayimprovekumarimotcuandoslavepuntafacultyjeromeumarawstyrereitherrepresentativenagliliyabformlabasambisyosangduwendetumatanglawpagtataasnagtagalaplicacionesmaipagmamalakingpangalantabingitinaasiikotinspirationmaya-mayamaibigaysantomakisigspareelvislittlepagkat