Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

2. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

3. Masyadong advanced ang teknolohiya ng bansang Japan kung ikukumpara sa ibang bansa.

4. The wedding reception is a celebration that usually follows the wedding ceremony.

5. Kukuha lang ako ng first aid kit para jan sa sugat mo.

6. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

7.

8. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

9. Nag-aaral ako para sa aking mga eksaminasyon, bagkus ang mga kaibigan ko ay nag-aaya ng lakad.

10. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

11. Ngunit ang bata ay mahinahong sumagot.

12. Las vendas estériles se utilizan para cubrir y proteger las heridas.

13. Panalangin ko sa habang buhay.

14. Maglalaro nang maglalaro.

15. La tos productiva es una tos que produce esputo o flema.

16. The decision to release the product early was a risky but ultimately successful strategy.

17. Ang pogi ng BF mo Maria, sana-all!

18. ¡Feliz aniversario!

19. I just launched my new website, and I'm excited to see how it performs.

20. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

21. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

22. Twinkle, twinkle, little star.

23. Sa tulong ng meditasyon, mas napalalim ang aking kamalayan sa aking sarili at emosyon.

24. Napakaganda ng mga pasyalan sa bansang Singapore.

25. Bumili ako ng pasalubong sa tindahan kahapon.

26. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

27. I have been studying English for two hours.

28. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

29. Confocal microscopes use laser technology to create 3D images of small structures.

30. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

31. Ang reception ng kasal ay nagbibigay ng pagkakataon para ipagdiwang ang bagong kasal at kumain ng masarap na pagkain.

32. Hinugot niya ang susi sa kanyang bulsa at binuksan ang pinto.

33. Sige, oo na lang tayo kahit sa totoo lang, ang baduy.

34. Matumal ang mga paninda ngayong lockdown.

35. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

36. Football coaches develop game plans and strategies to help their team succeed.

37. Ipanghampas mo ng langaw ang papel.

38. Sa paligid ng balde, nakikia niya ang kanyang anino.

39. Hinawakan niya iyon sa magkabilang tirante.

40. One of the most significant impacts of television has been on the way that people consume media

41. El estudiante con el peinado raro está llamando la atención de sus compañeros.

42. Sa bawat tagumpay, dapat tayong magpasalamat at magbigay ng pagkilala sa mga taong tumulong sa atin, samakatuwid.

43. Nasa labas ng bag ang telepono.

44. Pagkatapos mag-apply ng pabango, ang aking sarili ay naging mabango at kaakit-akit sa amoy.

45. Malulungkot siya paginiwan niya ko.

46. If you think he'll agree to your proposal, you're barking up the wrong tree.

47. Iwanan kaya nila ang kanilang maruming bayan?

48. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

49. Inakala nga noon ng mga magulang na hindi na magkakaanak dahil matanda na ang kanyang ina pero isinilang parin siya.

50. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

Recent Searches

dietlandotiketniligawanadicionalessamakatwidpariiniinomnatingalabumababamatchingglobaldrenadoouedalandanabalagamotshowskatabingjoshbilinrabecommunicationsconventionalshockdinkumaripasimaginationearlybinabaanmuchoschessalingjerrysoonfacultylasingwhetherprogresskapilingtutorialseyevasquesbadmagingferrerdollarmasokplagasawitinpiyanojustindrinkskanya-kanyangfilipinalipaddadalomagbibiladalignsmiyerkolesibaliksampungmag-anakiniindakauntinakabuklatrespektivefiancepagtatanghalsustrabajarkatedraltatayostillnakagalawkinatatakutannagtutulungannanghihinamadnagbabakasyonkaysapleasenaghuhumindignahihiyangpagkuwatatlumpungpaglalabadanapakamotnagmungkahimakauuwikapangyarihannegosyantelumalangoykagandahaggamitinniyamagsabibihirangbilibidpagbibiroalagangcosechar,umagangproducenagdalaipinatawagkagubatannaglaonbumaligtadkatolisismoarmaelgasolinanakakakuhanakatitigtahimikngumingisiapatnapudesisyonanmagbibigaytindakomedorbumibitiwmagkaharapmakatatlohayaanminatamiskulturfencingpeer-to-peernagliliwanagmagpagupitnakainkusinaisinarapanatagsakopininomsakyanfollowinggatolpasasalamatbinitiwanattorneycynthiamantikanakabiligrowmaalwangandoycocktailnakatinginpulitikogigisingpatonganubayannilapitaninnovationbibilhinlupainhinukaybibilipagkathagdantinitindawednesdaymakulitparehasnapapikitsalespromoteslaveipinatawlarangannapagod1977angelailagaysurroundingsamparoelvistigreprinceampliasinagotcellphonepalapitpangitcinechildrenwerepaghingisayaudiencepedrobirthdaynasanreguleringzoomskyldesjokebigong