Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

2. Nasa Canada si Trina sa Mayo.

3. She missed several days of work due to pneumonia and needed to rest at home.

4. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

5. Ano ang ginawa ni Tess noong Marso?

6. Nagmungkahi ang dentista na ipalinis ko na ang aking ngipin.

7. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

8. Ang saranggola ay gawa sa papel, kawayan, at plastik.

9. "The better I get to know men, the more I find myself loving dogs."

10. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

11. Masyadong matarik ang bundok na kanilang inakyat.

12. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

13. She is playing the guitar.

14. Natuto siyang lumaban sa kaniyang mga magulang.

15. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

16. Amazon's Kindle e-reader is a popular device for reading e-books.

17. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

18. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

19. Ang kakahuyan sa paligid ng aming tahanan ay nagbibigay ng kahanga-hangang mga tanawin sa tuwing taglagas.

20. Kasabay ko si Anna na magtanghalian sa canteen.

21. Acara keagamaan, seperti perayaan Idul Fitri, Natal, Nyepi, dan Waisak, dihormati dan dirayakan secara luas di Indonesia.

22. Bitte schön! - You're welcome!

23. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

24. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

25.

26. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

27. Paano ako pupunta sa Intramuros?

28. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

29. Elektronikken i en flyvemaskine kan hjælpe med at overvåge flyvningen og opretholde sikkerhed.

30. The stockbroker warned his client about investing in risky assets.

31. He thought it was a big problem, but in reality it was just a storm in a teacup.

32. Les programmes d'études sont élaborés pour fournir une éducation complète.

33. Ang takip-silim ay isa sa pinakamagandang panahon upang maglakad-lakad sa gabi.

34. Niloloko mo ba ako? Ang lamig lamig pa eh!

35. Ibinigay ko ang aking tulong sa mga naghihirap upang masiguro ang kanilang kaligtasan.

36. They have been studying for their exams for a week.

37. Está claro que necesitamos más tiempo para completar el proyecto.

38. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

39. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

40. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

41. Mabilis ang takbo ng pelikula.

42. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

43. She has completed her PhD.

44. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

45.

46. Noong una, sinasagot niya ang mga panunuksong ito.

47. The judicial branch, represented by the US

48. Bigyan mo muna ako ng dahilan kung baket. sabi ko.

49. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

50. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

Recent Searches

dietsellingmatapangbabeshumigabaryopagsayadgracengipingnatanggaplabing-siyammapsinakopkampomalakasmahabangseekrolandsubjectmagkasintahansaleseveningbulaklaksasayawinproducirbinge-watchingnahantadmagbakasyoncomunespalaginapakamisteryosohumalakhakpresidentialkaloobangsaritainilistamedisinahimayinsongsbesespabulongexperience,sawamodernebabenakalockpambahaypeepikinamataynandiyanhawakdakilangpdamawawalasolidifymakahiramcallbranchinitmatchingmagdilimbadauthorsulyaphigh-definitionnalugmokmaanghangbihasapanatilihinsicabelievednagawangpatientkanayangmamayamisteryoalanganmaulinigannatalongpinisilahaslarawankaybilisantoknakakarinigpilipinaswatchmarsodiferentesartistsgrewsquatterpagputibalediktoryanupuancigarettepaskongcreationmagsungitmuchherramientagenerateaidbasahanbio-gas-developingpaulit-ulitpagtawaventabrasooftenaalisiskoiiwasannapaluhasinkisinaboyanihinrailnag-replynagagandahanpitumpongdireksyonmakikipaglarouminomkrusdi-kawasakalanlaborevolvetumindigbinabahinanaplamanharapisamaspreadgitarasakristancompletetakotmonetizingmakakawawarecentnecesitalinggo1970spakakatandaanmukhangmamanhikanteachermagbibiyaheeskwelahanpresleyperseverance,siyamatangperlanagmamadalinaglulutobilllookedmangingibignagsisigawbalancesstaykontrasumamaumiimikmatagumpayparehasmagalitdisenyosikipbackgrabeerapmanilbihantarcilanilalangrelovotesvisualmichaelmakapagempakejeromemusicalstorehiwapanaynauliniganlumikhanagdiriwangtinaasanmurang-murasumayagospelamericakaninanasagutanbiyas