Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Yeah. Mabuti na muna siguro yung ganun.

2. Laging pinapasaya ni Nicolas si Helena kaya tuwang tuwa ang mga magulang nito sa kanya, itinuring na siyang kapamilya ng mga ito

3. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

4. Where there's smoke, there's fire.

5. The news might be biased, so take it with a grain of salt and do your own research.

6. Eksport af fødevarer fra Danmark er en vigtig del af landets økonomi.

7. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

8. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

9. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

10. Ang bawat gabi, ang aming katiwala ay nagiigib ng tubig mula sa poso upang punuin ang tangke ng bahay.

11. Jacky! napalingon ako ng marinig ko ang boses ni Aya.

12. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

13. Eh kelan niyo ba balak magpakasal?

14. Gaano kabilis darating ang pakete ko?

15. Nawalan kami ng internet kaninang madaling araw.

16. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

17. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

18. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

19. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

20. Estudyante sina Rita at Fe sa UP.

21. Bumili ako ng pasalubong sa tindahan kahapon.

22. Sa takip-silim, mas maganda ang kulay ng langit dahil sa kakaibang mga kulay.

23. Ako si Rodona ang diwata ng budok na ito.

24. He juggles three balls at once.

25. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

26. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

27. Ang laman ay malasutla at matamis.

28. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

29. Anong bago?

30. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

31. El actor hizo un comentario controversial que está llamando la atención de los medios.

32. Uncertainty is a common experience in times of change and transition.

33. I love to celebrate my birthday with family and friends.

34. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

35. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

36. Dumadating ang mga guests ng gabi.

37. She has made a lot of progress.

38. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

39. Pasensiya na kayo, wala po akong relo.

40. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

41. Kasama ko ang aking mga magulang sa pamanhikan.

42. Ang mga manggagawa at magsasaka ay kabilang sa sektor ng anak-pawis.

43. Umuwi na tayo satin.. naramdaman ko ang pagtango niya

44. I baked a delicious chocolate cake for my friend's birthday.

45. Nahulog ang bola sa kanal kaya’t hindi na nila ito nakuha.

46. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

47. Ang aking kabiyak ay ang aking tahanan, kung saan ako nararamdamanang tunay na pagmamahal at suporta.

48. Sa mapa, makikita mo ang mga pook na may magandang tanawin.

49. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

50. Ang pangamba ay maaaring maging mabuting tagapag-ingat upang maiwasan ang posibleng peligro.

Recent Searches

nakapagngangalitdietnaaksidentekatamtamanisinumpaturnmagkapatidpagsumamoeksportensumasayawtanawmanuellalabhanknowngovernorsnagtatakatawasiopaoayokopagkabuhaydisyembrekumanandaangnakabulagtangnakangisingaguamusicalesplacenapatawagsuccesskuyareaderssubject,amerikaamericataxikanilamapapakinauupuanlondonpatutunguhanbecametrainsipinamilitradenabalitaanniyaventafysik,gasolinanakakapasoktinikmansalbahengkatibayangbagamatnag-aagawanmonitornyaninspireuniversitiesnaghubad4thkaintsakapampagandasinebumababamahabolinakyatkristoumagawstarnilolokoaregladokinaindi-kawasakaloobanmarangalisulathistorylinawnarooniniirogbinabaeksamcardnaglabamoodnagtalagasaktanmodernmanghikayatumiinitmangingibigbroughtpaalamayusinconkinakailangangnapanoodmagpakasalattorneylilimyakapinnaantigeducativasnaalisgagambasino-sinopetsanghinogikinagalitkasingbayadadvancedgigisingkargahanpagtatanimitutuksoabenehinagpismagtataposkondisyonimpactedfallanakikiabumabahasumabogmappaskonangagsibilitokyofremtidigeumiiyakuulaminmartestelevisedkalarosukatpaglingonnagbakasyonpagkasabitatawagtumatakboinfluencesriconakakatandabalemukao-onlinesupilinnagpakunotpagngitilayuanhumigaconvey,kayosaritainilistaiikutanbumotohimayinpangyayarisiksikanganitomarasigannagniningningactorriegasisikattiyakpalancasweetpresidentialliv,kakuwentuhandiseasesbiologifollowing,storynakalockdondebabenagyayangkasintahanagilasubjectnakainsuwailsellingtopicsementonanunuribopolstog,piernagsamabetweenpinakidalainom