Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

2. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

3. Mahalagang magkaroon ng emergency fund upang maiwasan ang pagkakaroon ng utang sa panahon ng krisis o emergency.

4. Eine Inflation kann auch die Investitionen in Forschung und Entwicklung beeinflussen.

5. Cutting corners in your exercise routine can lead to injuries or poor results.

6. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

7. At sana nama'y makikinig ka.

8. Gusto kong tumakbo at maglaro sa parke.

9. Pagkat kulang ang dala kong pera.

10. L'entourage et le soutien des proches peuvent également être une source de motivation.

11. Hindi dapat puro kababawan lang ang pinaguusapan ng mga tao, kailangan din ng mga seryosong usapan.

12. Ang paglapastangan sa mga propesyonal at kanilang propesyon ay isang paglapastangan sa kanilang dedikasyon at pagsisikap.

13. Sa dapit-hapon, masarap tumambay sa beach at mag-enjoy sa tubig.

14.

15. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

16. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

17. Umihip ang malamig na hangin, waring may paparating na masamang balita.

18. Sa mga perya, naglipana ang mga tao na naghahanap ng libangan.

19. Piece of cake

20. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

21. Einstein was offered the presidency of Israel in 1952, but declined the offer.

22. Medarbejdere kan arbejde i forskellige miljøer som kontorer eller fabrikker.

23. Lingid sa lahat, si Tarcila ay isang diwata.

24. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

25. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

26. Ang pagkakaroon ng karamay at suporta mula sa mga mahal sa buhay ay makatutulong upang malunasan ang pangamba.

27. Buti naman. Ayoko mahawaan ng kuto eh.

28. Muchas personas disfrutan tocando instrumentos musicales como hobby.

29. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

30. Naku hindi na po. Ayos lang po ako.

31. Las vacaciones son un momento para crear recuerdos inolvidables con seres queridos.

32. All these years, I have been overcoming challenges and obstacles to reach my goals.

33. Ang albularyo ang tumulong sa pamilya para maalis ang sumpa sa kanilang lupa.

34. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

35. By refusing to compromise, she ended up burning bridges with her business partner.

36. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

37. May bakante ho sa ikawalong palapag.

38. AI algorithms are computer programs designed to simulate intelligent behavior.

39. The sun is setting in the sky.

40. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

41. They admired the beautiful sunset from the beach.

42. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

43. Hindi mo na kailangan humanap ng iba.

44. La foto en Instagram está llamando la atención de muchos seguidores.

45. Ang biglang pag-alsa ng mga manggagawa ay binulabog ang industriya ng paggawa.

46. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

47. Ang nababakas niya'y paghanga.

48. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

49. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

50. El agua tiene propiedades únicas, como la capacidad de disolver sustancias y regular la temperatura.

Recent Searches

dietambisyosangmarangyangnakapagngangalitiiwasanmatangbotemag-asawangpasyentesurgerynamilipitnapatakbomayabangpinag-aralanmaskarapiecestsismosapakibigaynakakaanimdumagundonguusapankaninasequepangalanparatingmeankalongmagpalagomaghilamosspendingkargahandarktumahimikkinalilibinganhawakumagangkahariantig-bebentehuluinilalabasbarung-barongotromakikipaglarosakaymawawalahinatidnoonmonumentomerelaylaynakilalaeducationpasensiyaritopopulationmagawaskyldes,espigashydelngayoconclusion,domingonakitulogipinadalaindependentlypesorealnanaykumakapittsakatmicacigarettengisikalan1954kumalmanagtatakboeclipxefulfillingbinilhanumagawsinusuklalyansumigawklasepaghabagownataquestagaytaynakahantadtuktokmaghatinggabiagilityerapconsiderarbakunapyestamindballpaslitlackparticipatingreboundcarlogrammaralmacenarmagsi-skiingsumalafertilizerlalargathingsunconventionalawaremakabawilargermataaspersonalkaguluhaniniisipgulatpagsalakaysamamakakanagbibigayanmaghahatidkrusi-rechargebagoabriltanggalinmakikinigtrainingsiniyasatpinakidalalakadbosesmemoworkshopdesarrollaronusinglaganapinaapiinterpretingreturnedinteractfaultnapatingalamonetizingsegundotodotapecallingpigingre-reviewworrystagesigurosinagotsinomayroonpansolremotefar-reachinghanapbuhaygloriamissioncultivoinvestmensnaiwanggayunmanjobsspiritualsyanggitaranag-emailbehavioroutlineaidnaghihirapefficientcompleteathenaspreadnapapatinginalapaapkuwentoentertainmentpinagkiskisbabekatagalanlondonbalahiboipinamilimarketinginaabutanmatigaspresence,mahinogsinunud-ssunodpagkabuhay