Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

2. Gawa ang palda sa bansang Hapon.

3. Paki-basa po ang kuwento para sa akin.

4. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

5. Nous avons opté pour une cérémonie de mariage intime.

6. Narinig ng mga diyosa ang kayabangan ng bata.

7. Arbejdsgivere kan fremme mangfoldighed og inklusion på arbejdspladsen for at skabe en retfærdig arbejdsmiljø for alle.

8. Hindi ibibigay ng Panginoon sa iyo ang isang pagsubok kung hindi mo ito kaya, magtiwala at maniwala ka lang sa Kanya.

9. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

10. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

11. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

12. Wala na siguro sya, baka natulog na inantok na.

13. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

14. Ang mga ibon ay wala nga namang mga pangil tulad nila kaya isinama din nila ito sa pagdiriwang.

15. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

16. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

17. Las personas pobres a menudo enfrentan barreras para acceder a la justicia y la igualdad de oportunidades.

18. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil ito ay maaaring maging dahilan ng depresyon at iba pang mental health issues.

19. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

20. Pumunta si Clara sa bahay ni Maria.

21. Kinakailangan niyang kumilos, umisip ng paraan.

22. It was founded in 2012 by Rocket Internet.

23. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

24. Hindi pa ako nakakapunta sa Barcelona.

25. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

26. The website is currently down for maintenance, but it will be back up soon.

27. Microscopes are commonly used in scientific research, medicine, and education.

28. You can't judge a book by its cover.

29. They are not attending the meeting this afternoon.

30. Naglalaro ang walong bata sa kalye.

31. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

32. Magsusuot ako ng Barong Tagalog.

33. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

34. Napapalibutan ako ng poot habang pinagmamasdan ko ang mga taong nagtataksil sa akin.

35. Pedro! Ano ang hinihintay mo?

36. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

37. The chef created a series of dishes, showcasing different flavors and textures.

38. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

39. Kailangang di niya malimutan ang araw na ito.

40. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

41. Dumalaw si Ana noong isang buwan.

42. Palayo na nang palayo ang tunog ng kampana habang umuusad ang gabi.

43. "Dogs come into our lives to teach us about love and loyalty."

44. Oo, malapit na ako.

45. Give someone the benefit of the doubt

46. Sira ang elevator sa mall, kaya't napilitan silang gamitin ang hagdan.

47. May I know your name so we can start off on the right foot?

48. If you keep beating around the bush, we'll never get anywhere.

49. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

50. If you quit your job in anger, you might burn bridges with your employer and coworkers.

Recent Searches

piecesdietpatongngipingpagbahingochandovideos,kinahuhumalinganpagkalungkotnakapagngangalitbayaranpinakamagalinghealthierkaaya-ayangnabalitaanmagkaparehopinagpatuloynapaplastikanmakakatakashinagud-hagodbuhaymahiwagangnagawangibinubulongkapangyarihangnakatirangglobalisasyonkagandahannaupopagkahaponapakalusogmagsusuotbabasahinnaiilaganpaki-chargeleksiyontumatawagisulatdahan-dahannaabutanna-suwaysang-ayonadgangnakasakitkinumutanlandlinenami-missnakakainmakuhaleadersmaliwanagkwartomedicinepalasyojosieumikotcombatirlas,manahimikpakakasalanpeopletaoslungsodsistemasvideospagiisipguerreronewspantalonbihirangisasamakarapatangsakalingmagselosnakarinigika-50reguleringbusninyoleenilapitangasmenbanlagomfattendetelalittleyamanydelserpresencematangkadglorialumbayadvertisingsocietybahagyangcommercialpalayokbarcelonapromisesunud-sunoditinaobkindergartencarolkulotpublicationpeppyguidancesmileprosesogagambalazadalalongmaatimtarcilanaghinalamalayadaladalaflavioxixmaidnagpuntapuwedenogensindebalotredesbinawipetsangcalciummadamidinalawlapitaninfectiousadangvehicleshouselangkartonpromotingaddeksamaidbeginningchessabstainingpressdragonakintirantecoatginisinglimospitakabatigabepumuntamisusedvotesseeknag-ugatstringtechnologysummitsecarsepacebinilingpatrickleadgeneratedincludecrazynagtataasniyomatandatooisdangfieldfreelancerlumuwasnatirafar-reachingpangalanhojasnamumulakaragataninyomalimitpagpapakalatnagtitiisgumagalaw-galawnagtutulunganpinakamaartenghumiwalaypaglalaitcultivapinabayaanhinawakannagmamadalinapatakbobestfriendiintayintuluyan