Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

2. Araw araw niyang dinadasal ito.

3. Bahay ho na may dalawang palapag.

4. Sa dakong huli ko lang narealize na mali ang ginawa ko.

5. Ang snob naman neto. Alam mo ba kung anong oras na?

6. Ang kaniyang dugo ay nakakagaling ng mga sakit.

7. Mucho gusto, mi nombre es Julianne

8. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

9. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

10. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

11. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

12. Bumili ako ng sapatos sa Shopee.

13. Ikinuwento ng bata sa babae na lason ang mga bungang ito.

14. Hindi na niya makuhang laruin ang beyblade bagamat ayaw niya itong bitiwan sa loob ng kaniyang kamay o di kaya'y bulsa.

15. Marami akong agam-agam sa aking mga plano dahil sa mga hindi nakasiguraduhan sa buhay.

16. El lienzo es la superficie más común utilizada para la pintura.

17. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

18. "Dogs are better than human beings because they know but do not tell."

19. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

20. Sasagot na sana ulit ako nang lumabas ng CR si Maico.

21. Aller Anfang ist schwer.

22. Sa kabila ng paghihinagpis, nagsikap ang mga residente na bumangon matapos ang trahedya.

23. Ang pagkukubli ng mga katotohanan ay nagpapahiwatig ng kawalan ng interes sa realidad.

24. Nandiyan po ba si Ginang de la Cruz?

25. Nagpapasalamat ako sa aking mga magulang dahil sa kanilang bukas palad na pagtanggap sa akin kahit anong desisyon ko sa buhay.

26. Sa halip na umalis ay lalong lumapit ang bata.

27. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

28. I admire my mother for her selflessness and dedication to our family.

29. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

30. Ay shet. Ano ba yun natanong ko. Biglaan.

31. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

32. LeBron James is a dominant force in the NBA and has won multiple championships.

33. The feeling of frustration can lead to stress and negative emotions.

34. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

35. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

36. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

37. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

38. Malapalasyo ang bahay ni Ginang Cruz.

39. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

40. She speaks three languages fluently.

41. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

42. Magsasalita pa sana siya nang biglang may dumating.

43. Ipapainit ko ho ito sa kusinero namin.

44. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

45. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

46. Parehas na galing sa angkan ng mga mahuhusay humabi ang mag-asawa.

47. Las heridas infectadas pueden requerir de antibióticos para su tratamiento.

48. Los bebés recién nacidos tienen un olor dulce y tierno.

49. Make sure to keep track of your sources so that you can properly cite them in your book

50. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

Recent Searches

piecesbihasadietisinaramakapangyarihangtinanggalnatigilanpackaginggumawahinandenpagsahoddollarpisarayeloantokninyongkundimanbellpagpapatubomalumbayoraspampagandanagtakaprincemalagohimselfpootmagisingiyamothiningasalesliganagniningningjolibeenapansinabalakutodmasisavidtstraktrawsumarapdialledfuturemanilavelfungerendenasundosumagotnoomakesmadalasnagpagawatermtapusinyayaexplainlenguajelumusobbeyondmanonoodlulusognagdarasalconstitutionlegendsambitwowpinapagulongvidenskabenpaglakidraft,waterpalakolstatingnangyayariumibigwalang-tiyaknyabawalmalinissigedisyembreusobagkus,kanilaseryosongnagtungobabasahinusedadditionally,tambayannegro-slavesnoongpanitikan,patichesskendisasagutinmakapilingsasapakinumiyaktoothbrushukol-kayibinigayuniversitiestibigroselleibonnungpangkatmaaarimaghahatidcurtainsyumuyukosiniyasatmagbabalatumaposnagbantaypinagkasundoginagawaprovidedmagsusuotsumalaboyetfeelingkubomagisiplabinsiyampalibhasaadvertising,twinkleipasokmahihirapuseminu-minutograduallykakayananmapdawdoktorrocktumatawadkamakailanlaamangarbejdsstyrkeindividualkuwadernomensajesnakasakitnakaangattinataluntonimpentulognakatagonegrospinisilgreatartekilongreserbasyongobernadornagtutulungananjoflamencoinstrumentalsitawnabighanitsealbularyomaariapatnapulamantokyojulietjunelargespecializedcandidatenabuhaypyestaalmacenarwaitbaguiodonenag-umpisaniyogtoolbantulotprobinsyaenergy-coaltodotakepatientnakikilalangriegamakapangyarihannagc-cravecakepuwedekalakimitigate