Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

2. Mahirap magtiis kung mahal mo sya.

3. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

4. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

5. Nag-pout si Mica saka kumapit sa braso ko.

6. She is not learning a new language currently.

7. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

8. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

9. Inakalang masaya siya, pero sa likod ng ngiti ay may lungkot.

10. Masyadong advanced ang teknolohiya ng bansang Japan kung ikukumpara sa ibang bansa.

11. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

12. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

13. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

14. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

15. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

16. Nakita ko namang natawa yung tindera.

17. Nasa harap ng pinto ang dalawang aso.

18. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

19. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

20. Les thérapies alternatives telles que l'acupuncture et la méditation peuvent aider à réduire le stress et améliorer la santé mentale.

21. Nanood sina Pedro ng sine kahapon.

22. La entrevista produjo una oportunidad única para conocer mejor al autor.

23. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

24. Hello? sagot ko agad pagkaangat ko ng receiver.

25. Baby fever can affect people of various ages, backgrounds, and genders.

26. Dapat natin itong ipagtanggol.

27. You can't judge a book by its cover.

28. There are a lot of opportunities to learn and grow in life.

29. Ngunit marumi sila sa kanilang kapaligiran.

30. "Let sleeping dogs lie."

31. Some people invest in cryptocurrency as a speculative asset.

32. Si Ogor, na kamakailan lamang ay bumabag sa kanya, ang malimit magsisimula ng panunukso.

33. Hindi ako sang-ayon sa mga patakaran na ipinatutupad ng gobyerno.

34. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

35. Babalik ako sa susunod na taon.

36. The project is on track, and so far so good.

37. Sa mga tono at salita ng kundiman, nabibigyang-pansin ang pag-asa at paglalakbay ng mga pusong nagmamahalan.

38. Mag-ingat sa aso.

39. Subalit pinipilit pa rin niyang maging malakas bagamat talagang di na kaya ng kaniyang pang tumayo ng kahit ilang sandali man lang.

40. En invierno, el cielo puede verse más claro y brillante debido a la menor cantidad de polvo y humedad en el aire.

41. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

42. Ang malambot na lilim ng ulap ay nagbigay ng kakaibang kulay sa silong ng buwan.

43. Ikinuwento ng bata sa babae na lason ang mga bungang ito.

44. Magsabi ka ng totoo, kung di ay dadalhin kita.

45. We were stuck in traffic for so long that we missed the beginning of the concert.

46. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

47. Masarap at manamis-namis ang prutas.

48. Gracias por tu amabilidad y generosidad.

49. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

50. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

Recent Searches

dietbestmakikiraanlumuhodparagraphskabundukantillgayunpamanmuntikansumasakitpinagkasundomaghahabiexcitedsettingvictoriapa-dayagonalnandoonsinagotnapatunayanpasosbeerpunong-kahoynaabutanpagtutolpinasalamatansakristanlumikhaentrancemagsi-skiingmagkaibanginirapanrenatohinagud-hagodnakakapasokobservererkalalakihannagtitindanagbakasyonmagbagong-anyopagkapasokanak-pawislumiwagmakipag-barkadanagsagawanahuluganhumahangosmahahanaynapakahusaymagtanghalianalikabukinnananaghilisystems-diesel-runtutungonasasalinannakauwipinapataposnareklamomensahepaki-chargebisitakilongtumalonlumutangmagdamagengkantadangyumuyukosinusuklalyankinalakihanumagawrichdoble-karamaramikaliwatumapospundidocanteenmilyongnatuwamaghaponmarketing:stayibinibigayjoefe-facebookbihirangbilihinmatumallansanganbilibidnagtaposmagselosnasilawsamantalangtumatawadgusaliconclusion,benefitsnangingilidsigurobuhawipawishinilamabigyanlilipadtataasrecibirbaguioganuntransportninyongtatlongmatangkadtumakasofficelandslidelipatmakulitphilippinepangkattomorrowmatayogmaisipsisipainrolandma-buhaypisaramaipagmamalakingairconwasakdissepigingnakamakinangtibigevolucionadokarangalancarbonmanakbocineblusangharapyataubobingiiniinomlandosumuotubodilangarbejderlapitannasabingsalapangingimilagicalciummakapangyarihandawnatanggapulamtakeskablanleoomelettereservesipinadalanasasakupankalanmarchscientificveryvideofertilizeragakamatiscryptocurrency:pagkalipastvsmanuellegislativeforcesroboticnagreplysoon1973panaynakipagmatakawclientesmatalimtumaholmultoandyimprovebinabaventaspeedsagingvasquesdecisions