Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

2. Ang lugar na iyon ay tila isinumpa.

3. Nasa ibabaw ng mesa ang bag ni Clara.

4. At vedligeholde en regelmæssig træningsrutine kan være udfordrende, men belønningerne for ens sundhed og velvære kan være betydelige.

5. Psss. napatignin ako kay Maico. Naka-smirk siya.

6. Kumain ka na ba? Tara samahan kitang kumain.

7. I love you, Athena. Sweet dreams.

8. Matapos mahuli, nanumpa siya ng katapatan sa Estados Unidos.

9. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

10. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

11. Sa hatinggabi, maraming establisimyento ang nagsasarado na.

12. We have been cooking dinner together for an hour.

13. The game is played with two teams of five players each.

14. Hindi ibibigay ng Panginoon sa iyo ang isang pagsubok kung hindi mo ito kaya, magtiwala at maniwala ka lang sa Kanya.

15. Taking unapproved medication can be risky to your health.

16. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

17. Dahil lumamang naman sa pagkakataong iyon ang mga mababangis na hayop, sa kanila lumapit si Paniki.

18. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

19. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

20. Nahihilo ako dahil masyadong mainit ngayon.

21. Sinong may sabi? hamon niya sa akin.

22. It can be helpful to get feedback from beta readers or a professional editor

23. Palagi sya nagbibigay ng pagkain sa pulubi.

24. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

25. Elektronik er en vigtig del af vores moderne livsstil.

26. He blew out the candles on his birthday cake and made a wish.

27. Nang makita ang paparating na ulan, kumaripas ng uwi ang mga bata mula sa palaruan.

28. Mawala ka sa 'king piling.

29. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

30. Ang kakahuyan sa paligid ng aming tahanan ay nagbibigay ng kahanga-hangang mga tanawin sa tuwing taglagas.

31. Los héroes son ejemplos de liderazgo y generosidad.

32. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

33. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

34. They are cleaning their house.

35. The hotel room had an absolutely stunning view of the city skyline.

36. Saglit lang lang naging kami. Sabi niya sa akin..

37. Naramdaman ko ang pagdidilim ng aking paningin nang biglang nagpakalma ang mundo sa aking paligid.

38. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

39. I have been watching TV all evening.

40. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

41. Not only that; but as the population of the world increases, the need for energy will also increase

42. Me gusta preparar infusiones de hierbas para relajarme.

43. Their primary responsibility is to voice the opinions and needs of their constituents.

44. Uno de mis pasatiempos favoritos es leer novelas de misterio.

45. Laganap ang paggamit ng social media sa kabataan ngayon.

46. Ibinigay ko ang lahat ng aking lakas at determinasyon upang makamit ang aking mga layunin.

47. La comida tailandesa es famosa por su sabor picante.

48. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

49. Sa dapit-hapon, masarap mag-stroll sa mga kalye at maghanap ng masarap na kainan.

50. Dahil sa kanyang natatanging kakayanan, naging tanyag ang bata sa iba't ibang lupalop.

Recent Searches

palagipangingimigrammartiketmaaridietsuccessfulhinamakgandahanlalongayokomedicalpangungusaplaborwalisdisappointklimabilinbarnesulamproperlyspeechesnagbungatonwestcutsinunodpeepmanuscripttumirahangaringvisualmagtatakacombinedambagkanikanilangtuvotatlongnakakainnawawalanagmamadaliemocionanteedukasyonpoonhitpagpapasannangangakoamericanadgangsumamacigarettesspendingsaringdontvampiresflexibledatapwatresearchbuwaladditionbaulmaliniswordslatestformaspumuntanag-emailkapangyahiranstorynasaangelectedminerviegubatibinilisagapdialledmeanhawlasementoballbileryounginalisinalalayanlackdaangditoellalaylayelectionprovidecadenagodprofessionalpalayobayadmagbigaykarununganaktibistaphilosophicalnakataasnandiyanpapuntastagenaggingendseenbabenatingcontinuesbulsainterpretingaddreportstudentellenchamberssutilmariaumiimikpagsahodmagkasintahancommerceseparationlearnandycablegottumunogunattendedconstitutionactionmuchannacasesregularmenteslavehapdimainstreamguiltypinagsikapannaiisipmang-aawitseriouspinakamatabanganungyeloemphasispalancakumikinigpagkakalutoencompasseslendingstartedprogramacontinueisinamacomplexinterviewingconditionclassmateilingevolvecuandoreallyableremotenanlakikailannagsusulatkilokinasisindakanamparogalitsinceroboticcompanynangingilidsinisirapambatangmagdoorbellkayang-kayangkabiyakmaibalikpinag-aaralanayusinramdampanghihiyangtinakasanmaestrobinitiwanpagtawailanpaparusahannakabibingingpalibhasaantoktoypakikipaglabankumembut-kembot