Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. She has just left the office.

2. Ano-ano pa po ang mga pinaggagagawa ninyo?

3. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

4. Ang aking Maestra ay napakabait.

5. Sa mga perya, naglipana ang mga tao na naghahanap ng libangan.

6. Sí, claro, puedo confirmar tu reserva.

7. Hinintay ko siya sa labas ng kanyang opisina upang sabay kaming kumain ng hapunan dahil gustong-gusto ko siyang ligawan.

8. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

9. Dapat kong bilhan ng regalo si Maria.

10. Nagsusulat ako ng mga pangaral at talumpati para sa mga okasyon sa paaralan.

11. Dali na, ako naman magbabayad eh.

12. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

13. Kapag nagluluto si Nanay, ang buong bahay ay napupuno ng mabangong amoy ng pagkain.

14. Ahh... haha. Umiling na lang ako bilang sagot.

15. Hinde ko alam kung bakit.

16. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

17. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

18. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

19. The United States is a federal republic, meaning that power is divided between the national government and the individual states

20. The website's analytics show that the majority of its users are located in North America.

21. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

22. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

23. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

24. He is not having a conversation with his friend now.

25. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

26. Humahanga at lihim namang umiibig ang maraming kabinataan sa tatlong dalaga.

27. In conclusion, the telephone is one of the most important inventions in human history

28. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

29. Ang pagkakaroon ng karamay at suporta mula sa mga mahal sa buhay ay makatutulong upang malunasan ang pangamba.

30. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

31. Sa lilim ng kanyang sombrero, tahimik na nagmamasid si Lola habang binabaybay namin ang kalsada.

32. Ang mga kundiman ay nagpapahayag ng kahalagahan ng pag-ibig at pagmamahal sa ating bayan.

33.

34. Bumili si Ryan ng pantalon sa palengke.

35. Las suturas se utilizan para cerrar heridas grandes o profundas.

36. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

37. Ipantalop mo ng kamote ang kutsilyo.

38. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

39. Arbejde er en vigtig del af voksenlivet.

40. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

41. Kapitbahay ni Armael si Juang malilimutin.

42. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

43. The acquired assets were key to the company's diversification strategy.

44. Les riches dépensent souvent leur argent de manière extravagante.

45. Ang lakas ng ilaw ng kanyang flash light.

46. Has she taken the test yet?

47. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

48. Sa harap ng mga bisita, ipinakita niya ang magalang na asal ng mga kabataan sa kanilang pamilya.

49. Inakalang wala nang pag-asa, pero may dumating na tulong.

50. Lulusog ka kung kakain ka ng maraming gulay.

Recent Searches

dietheheoperahanindiaphilippineipaliwanagpinyadiferentesnagdarasalbuhaypinagsasabinapagpatidistansyausodiplomapaycomosmallnagpakilalastoptradeaplicamasasalubongrinnatatapossinghalgumawanapaghatiannatinreachganyanwatawatpumayagbulalasinuulcerdoble-karabinatilyokendidisyembreumikotnakakaenkassingulanginyobilhinkasapirinbuntiskatagalpalibhasagreenlalargaboyfriendkindergartenmusiciankulturenergiinakakaininmagwifikumaripastoyelectedflynabuoumagawmakakuhavetonabubuhaymobileclubmanirahanrelievedhumigit-kumulangmadadalajosieumupodisensyonagbibiroisusuotnochenataposguidancekilaynaghubadnasasakupanpagmasdanlaganaplalimgrinstamaopgaver,isinalangorganizeblusangcompaniesikawalongcitizenmatakotpinahalatatransmitidaskaniyakayinvolveabswalkie-talkieconditiontipidrollednagtrabahooverviewpopulationfacilitatinglefttargetkitstreamingpagkainiskahulugandeclaresimplengnaglalaronaglipanangnyangreenhillsbumabagtagalababokpaglayasngitiproductionsigatresrestaurantshopeetuwingguhitomghappierpwedepag-isipangreatstreetsilbing1940popularizeusaramdamuponaywankainisonceiniuwihamaklasinggamothydelseedagataong-bayanbibilithoughtsmatindingfertilizerchavitinteligentestiyaenterpaskosaginglaterideasbibiggagandamalezamagkaibaspeednagagandahanpoliticalpaghalakhakmahalaganagpepekepagtiisantumagalkinagalitantenerdollypinuntahanmahawaanpagsahodlumagomakakapaghahabicynthialunesadditionallylegenddejahadmartes