Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. The United States is the third-largest country in the world by land area and the third most populous country in the world.

2. Umakyat sa entablado ang mga mang-aawit nang limahan.

3. Binili ni Rita ang damit sa tindahan.

4. Las hojas de la hierbabuena se pueden usar para hacer té o mojitos.

5. Medarbejdere skal ofte undergå årlig evaluering af deres præstation.

6. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

7. The awards ceremony honored individuals for their charitable contributions to society.

8. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

9. Agradezco profundamente tu dedicación y esfuerzo.

10. I baked a delicious chocolate cake for my friend's birthday.

11. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

12. Nagtuturo kami sa Tokyo University.

13. Galit na galit ang ina sa anak.

14. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

15. Ang taong hindi marunong lumingon sa pinanggalingan, ay hindi makakarating sa paroroonan.

16. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

17. She has quit her job.

18. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

19. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

20. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. He collects stamps as a hobby.

23. A couple of dogs were barking in the distance.

24. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

25. Ang ganda talaga nya para syang artista.

26. Anong hindi? Eh pulang-pula ka na oh!

27. Natawa nanaman sya, Hindi, maganda sya.

28. Tuwing gabi, ang mga tao ay nagpapahinga at natutulog upang mag-refresh ang kanilang katawan at isip.

29. Kumakain ka ba ng maanghang na pagkain?

30. Sa brainly ako madalas nakakakuha ng ideya.

31. Sa bus na may karatulang "Laguna".

32. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

33. Narinig kong sinabi nung dad niya.

34. En España, el cultivo de la vid es muy importante para la producción de vino.

35. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

36. Hiram na libro ang ginamit ko para sa aking research paper.

37. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

38. Aerob træning, såsom løb og cykling, kan forbedre kredsløbets sundhed og øge udholdenheden.

39. Ang pagkikita at pag-uusap sa isang propesyonal na tagapayo o therapist ay nakagagamot sa aking emosyonal na kalagayan.

40. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

41. Andre helte er kendt for deres humanitære arbejde.

42. The king's legacy may be celebrated through statues, monuments, or other memorials.

43. There were a lot of flowers in the garden, creating a beautiful display of colors.

44. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

45. Ang mga mangingisda ay nagtatanim ng mga alon sa kanilang pagmamahal sa karagatan.

46. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

47. Di mana bumi dipijak, di situ langit dijunjung.

48. Miguel Ángel Buonarroti fue un artista italiano del Renacimiento.

49. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

50. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

Recent Searches

dietnagbiyaheisdasaidfloorgawaingbukodbetweentutorialsperyahanpaidpagtatakapananglawkontinentengnakakapamasyalnangagsipagkantahanateyukolumahokpasensyamakangitimakikikainsikre,kasawiang-paladpagtiisantabiengkantadahalu-halonapapansinprimerosbulaklaknagtakacriticsloansleytemerrymassessalarinrenaiamarangalnapadpadpagongproducereripinauutangleadersmabutimaghintayprobinsyacampaignsnapadaananungsakimnanggigimalmalbevaresupiliniconsfrescoexperts,pa-dayagonalkatotohananactingbargandaumiinitipagbilidrayberilogmaalikabokincreaseselecteddisplacementsetsdaddyupworkmahiwagakumalantogbagkus,nakalockipinanganakhaypagbatinagdaanpupuntapagkabuhaylangitnakatuondecreasenaliligofarnagkikitapinabayaankahoygatasginagawavelfungerendemarasiganlubosartistaedukasyonmakapalagmonumentosinaletpanunuksongnakasandigmalapadmgamalapitipanlinisfridayconditionmahahabaunangmiyerkulesistasyonmukhatmicakumantaingatanpangarapbahagyapumilisinapaksubjectmalinisstarbusfigureslimangitsuracontentcleanipagtimplabadgeneratedwhyelectpumuntapinatutunayanmayroonpinagpalaluansorrymayointroducesalamatnahuligayunmannapaplastikannagulatsundaekailannagkapilatliv,maliksinamumutlamahinacurtainsnanoodlumbaydurantenakariniggoodeveningkulotweddinggawinmakalingawitsagotalincrucialhadlikeinamaramotrebolusyonmasasamang-loobtinanggapfilmsanonagsusulatpinakamatapatkikitakapainpigingeducationfarmpromisevasquespambansangpinamalagipaglalabadadisenyongnag-aabangpawiincampiniuwingumingisidistanciamaghapontagtuyot