Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. The movie was rated R, and therefore she wasn't allowed to watch it.

2. Matayog ang lipad ng saranggola ni Pepe.

3. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

4. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

5. Hindi naman. Baka lang pagod ka na...

6. Ang kabanata ay nagtapos sa isang maigting na eksena o cliffhanger, na nagtulak sa mga mambabasa na magpatuloy sa pagbasa.

7. Nagmadali akong pumasok sa kalsada nang abutin ko ang dakong huli ng bus.

8. Doa juga bisa dijadikan sarana untuk memohon kesembuhan dan keberkahan atas orang yang sakit.

9. Nang matuklasan ng binatilyong apo na siya ay isang pangit na hayop na, kumarimot siya patakas sa baranggay.

10. Børn med særlige behov har brug for ekstra støtte og ressourcer for at trives.

11. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

12. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

13. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

14. Naghihirap na ang mga tao.

15. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

16. Hindi ako pumayag na hiramin ang aking laptop sa aking kapatid dahil baka masira ito.

17. Pull yourself together and stop making excuses for your behavior.

18. Ikaw pala, Katie! Magandang hapon naman.

19. Limitations can be overcome through perseverance, determination, and resourcefulness.

20. Naglalagay ng bulletin board ang guro sa silid-aralan upang maipakita ang mga gawain ng mga estudyante.

21. Teka, bakit namumula ka? Tsaka anong nangyayari sayo?!

22. Ngunit hindi napigilan si Magda ng kanyang mga anak.

23. Selain sholat, orang Indonesia juga melakukan doa melalui upacara adat dan keagamaan.

24. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

25. "The more people I meet, the more I love my dog."

26. Sa paligid ng aming bahay, naglipana ang mga bulaklak sa halamanan.

27. Sa tulong ng isang magandang pagsasalita at pang-unawa, ang tensiyon sa pagitan namin ay napawi.

28. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

29. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

30. Ayaw mo ba akong kasabay? maya-maya eh tanong ni Anthony.

31. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

32. Puwede siyang uminom ng juice.

33. The company is exploring new opportunities to acquire assets.

34. There are many different types of microscopes, including optical, electron, and confocal microscopes.

35. Mi novia y yo celebramos el Día de los Enamorados con una tarde de películas románticas en casa.

36. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

37. Ang sugal ay isang hindi wastong paraan ng paghahabol ng pera at tagumpay.

38. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

39. Si Ogor, Impen, pahabol na bilin ng kanyang ina.

40. Naglalaway siya sa bango ng kape na inilabas ng coffee shop.

41. Dadalo si Trina sa workshop sa Oktubre

42. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

43. Membuka tabir untuk umum.

44. Pagdukwang niya ay tuloy-tuloy siyang nahulog sa ilog.

45. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

46. Basketball is a team sport that originated in the United States in the late 1800s.

47. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

48. May klase ako tuwing Lunes at Miyerkules.

49. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

50. Kaya lumaki si Pinang sa layaw.

Recent Searches

makasarilingtoretenagbasaencompassesdietskypepresyomanunulatmisteryomoredividesbirobrucebileripipilittrainingrolejunioleftentermultocontinueusingtechnologicalhimisinulatmakatulogs-sorrykumaintennismagsugalnagsilapitkastilangtenderressourcernekartongcruzmagisipeksport,nagbentanagdudumalingbarongpalibhasasikrer,pinakamalapitgawinmongkumapitalaganglacsamananakabawigymsinkdollarmarilounaispagkaestarmagpuntadinitiposformakinagatdahilconectadossourcesbluereservationroofstockbernardomatalinobumangonhalamangpanalanginpwedemaipantawid-gutominnovationkailangannalalaglagnegosyonapatingintodoaraw-arawknowsexpresanmedidaaminkuryentemagkababataulongkakapanoodnagmungkahisaritanapagtantonakatitigaga-agakapintasangpakukuluanhulingbinibilikalayaanpaaralanawitanninyongcomputermabutibutoilagaysurroundingskulangdikyampaligsahangustosemillaslagisumindihislayawlearningpagsisimbangbalancesestilosactingnaiinggititinuringrestawanekonomiyalolaemphasizedmessagedoingmukhamusicianhulitinahakkuligliglangkay1950spaki-bukasinuulamedsapalangsagoteroplanosumasagotvelfungerendemaskivotesmanamis-namisbanggainnakatayotiyandisyempreatewebsitepinalayaspapeltvspag-aaralangkinatitirikanliignapigilanmagseloslunasmatutuloghiraminspirationnatitirangcompaniesempresastienennakisakaysubject,bloggers,merlindamaglalakadtobacconagtatampoerhvervslivetkara-karakachangemalinislarryteachtekstmulibranchesschoolsmatindingpasyalabanmedikalopisinamagkakapatiddiningpersistent,creatingherelargetaba