Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Mag-babait na po siya.

2. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

3. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

4. Nabahala si Aling Rosa.

5. Dedication is what separates those who dream from those who turn their dreams into reality.

6. Tsong, hindi ako bingi, wag kang sumigaw.

7. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

8. Emphasis can be used to create a memorable and impactful message.

9. Gusto ko ang mga bahaging puno ng aksiyon.

10. Ang laki ng wedding cake na ginawa ng kanyang ate.

11. Waring hindi pa handa ang kanyang puso na magmahal muli.

12. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

13. Limitations can be physical, mental, emotional, financial, or social.

14. Napatingin ako sa may likod ko.

15. Nagkakatipun-tipon ang mga ito.

16. The website's content is engaging and informative, making it a great resource for users.

17. Magkano ho ang arkila ng bisikleta?

18. No puedo controlar el futuro, así que "que sera, sera."

19. Beinte pesos ang isang kilo ng saging.

20. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

21. La pobreza extrema puede llevar a la inseguridad alimentaria y la desnutrición.

22. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

23. Salamat ha. aniya bago ako makapasok sa kwarto.

24. Ang mga manggagawa nagsisilbi sa kanilang kumpanya upang magtrabaho at kumita ng pera.

25. Landet er et godt eksempel på, hvordan man kan skabe en velfungerende

26. Nakipag bahay-bahayan kay Athena.

27. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

28. Hindi maganda ang magkaroon ng maraming utang dahil ito ay nagdudulot ng dagdag na gastos at kahirapan sa buhay.

29. Pakilagay mo nga ang bulaklak sa mesa.

30. Protecting the environment involves balancing the needs of people and the planet.

31. Der er mange forskellige typer af helte.

32. Halos de-lata na lang ang lagi nitong inuulam.

33. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

34. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

35. One of the most significant impacts of television has been on the way that people consume media

36. Pinaniniwalaang ang albularyo ay may kaalaman sa lihim na karunungan ng kagubatan.

37. Naglalaro kami ng 4 pics 1 word sa cellphone.

38. Napakamot na lang ng ulo si Kenji.

39. El acceso al agua potable es un derecho humano fundamental.

40. Sa simula ng kabanata, ipinakilala ang bagong karakter na magiging pangunahing tauhan.

41. Politics in America refers to the political system and processes that take place in the United States of America

42. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

43. Los asmáticos a menudo experimentan tos como síntoma de un ataque de asma.

44. La agricultura es una actividad fundamental en muchas regiones del mundo.

45. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

46. Gusto ng mga batang maglaro sa parke.

47. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

48. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

49. It is an important component of the global financial system and economy.

50. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

Recent Searches

dietayokosinimulanletterpalaykinainfamediscoveredtig-bebeintelightspartnerpinalakingilaninalalayanbridegenerationerinisgreencondonaritosueloreservedipinikitmenuinsteadawareattackneverreaddraft,circlenariningmagbubungafigurenerissadividesngunitlamangibinubulongprutassustentadonagbasaibinaonapatculpritbokedsakontinentengconvertidasskabtdinmontrealnabubuhaymangbringnaupopaglingonstandkakutisspecialjocelynsuwailpamanresumenpangetformattinaasangumagamitpagkatikimpioneerhudyatkakilalakatolisismopakibigaymabibingimagisipmagdaanaddimbeskargaisangpinyaabeneipinalutoplayeddecreaseroughallowsknowgaponceuponallowedpracticesbitawanparatingnaiinggitresultchamberseksaytednakaririmarimhinawakanpanghihiyangpinabayaancultivasinopaglalaitnanahimikhitsurapagpapasannagsasagotnakatayonakakapagpatibaynasasakupannagandahanninyongasahanpanatagendvidereniyanjulietunconstitutionallalobalikkindergartennalalamannakatapatkassingulangentrancemahinangsteamshipstitamaglaropanginoonpalantandaannaaksidenteipinaalamtumakbopinabulaanwalang-tiyakmanuscriptleofakemawalasinunodnakikihukayremainlossaksidenteburmapamimilhingkantonatiraisaacbumababasinundangmayvampireskauntinghanggangangelanareklamoumiyaksnamarietumalimblusangkissreviewmaanghangtransitlakasupangpisiclassespoongprogramming,nakaangatchavitmartessanisinasamakalalarosaranggolalalakadnagpalalimsilapangangatawansimbahannapakalusogpagkamanghavedvarendenalalaglagbahagyangkumalaspromisemahinaumanodiagnosesbernardo