Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. All these years, I have been grateful for the opportunities that have come my way.

2. Magandang ideya ang magbakasyon, datapwat kailangan ko munang mag-ipon.

3. Talagang hinahangaan ni Marie ang disente nyang kasintahan.

4. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

5. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

6. Mathematics can be used to model real-world situations and make predictions.

7. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

8. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

9. Si Bok ay dalawampu't siyam na taong gulang na labas masok na lamang sa bilangguan

10. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

11. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

12. Pumasok ako sa cubicle. Gusto ko muna magisip.

13. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

14. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

15. May mga taong nagkakaroon ng mga panaginip tuwing natutulog sila.

16. Aling hiwa ng baboy ang gusto mo?

17. You reap what you sow.

18. Inihanda ang powerpoint presentation

19. Human activities, such as pollution and deforestation, have a significant impact on the environment.

20. Saan siya nagtapos ng kolehiyo?

21. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

22. Nagpaluto ako ng spaghetti kay Maria.

23. Kinuha ko yung CP niya sa bedside table.

24. Ilan ang computer sa bahay mo?

25. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

26. My friends surprised me with a birthday cake at midnight.

27. I'm going through a lot of stress at work, but I'm just trying to hang in there.

28. The amount of knowledge that exists in the world is immeasurable.

29. I sent my friend a bouquet of flowers and a card that said "happy birthday."

30. At sa kanyang maninipis na labi, na bahagyang pasok sa pagkakalapat at maputla, ay naglalaro ang isang ngiti ng kasiyahan.

31. It was founded in 2012 by Rocket Internet.

32. mga yun. Ang mahalaga ay makapagempake ako agad.

33. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

34. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

35. La brisa movía las hojas de los árboles en el parque.

36. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

37. Ang laki-laki ng cardigan na ito.

38. Tumayo ako tapos tumayo rin si Carlo.

39. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

40. Ils ont déménagé dans une nouvelle maison récemment.

41. Ang mga himig ng kundiman ay nagpapalaganap ng mga kuwento ng pag-ibig na hindi matutumbasan ng anumang kayamanan.

42. Kailan at saan po kayo ipinanganak?

43. Tatlong araw na po akong hindi kumakain at palabuy-laboy dahil sa wala po akong tirahan, ang pagsumamo ng bata.

44. Better safe than sorry.

45. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

46. Sa kaibuturan ng aking pagkatao, alam kong gusto ko ng katahimikan.

47. In the years following his death, Presley's legacy has continued to grow

48. Actions speak louder than words.

49. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

50. Ibinigay ko sa kanya ang pagkakataon na magpakilala sa kanyang mga kaisa-isa.

Recent Searches

dietmahirappumuntaproviderevisekanilaboxnagtatakapalakadiamondpaumanhindaraanannasasaktanprogramminginakyatkamalayancirclenagalitnahulognagtagisanmakitatulalamataraynapasubsobkumbentonatatawapamburanai-dialkaharianhangaringtabilarrytalaganakasuotpanimbanggayunmannakahantadpinag-usapancultivationnotebookmariapinapasayatangeksasimenchantedkandidatopalaybutomataopokaklaseevolucionadogratificante,pumilialas-tresiikotresearchmakingcontent,matiwasaysiopaomagulayawnegroswebsitenewspaperskamiberkeleymagalangbagkus,pagtatakaquezonnatigilankatuladmalapittusongcaseskapitbahaymalinisultimatelymababangiswashingtonmaglalarocontentisinusuoteksportenmaya-mayaspeechespayongsabihingkwenta-kwentabiyernesmadulaslookeddumaramimgaorderintig-bebentemaghapongirltasabangkomasiyadokrusnag-iinomenergicallingroberthmmmmbumibilihellomininimizecenterkasingtigasayantag-arawtelajackzbalinglihimpagkaganda-gandapinipisilnaglahoahasdulialingpookotrobatadalawinnatandaanmaprhythmkatipunantanongbagamatpigingilocossystems-diesel-runprutasbahakinasuklamanpumupuntagooglekahulugannapilimasasalubonglasingtaksikinasetyembrenagtatrabahobuwayamatalikbulsakatolisismomasayang-masayakargangdisyemprepotaenailanginawasusinerissalupalopniyanimposibledeltutorialstubig-ulaninakalatulongjerryislandabrilcivilizationmalakasairconmagpahabaimpactsligayapunong-kahoybalancesmagagalingnatabunanmalihispaaralanmahigpitinadalawangkaibigannawawalasakyanpagputimagkanobecomingbinatilyoangkankaninoharapangawan