Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Kinasuklaman ako ni Pedro dahil sa ginawa ko.

2. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

3. There were a lot of boxes to unpack after the move.

4. Many cultures have their own unique traditions and customs surrounding weddings.

5. Cuídate mucho de esas personas, no siempre son lo que parecen.

6. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

7. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

8. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

9. He has been playing video games for hours.

10. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

11. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

12. Drømme kan være en kilde til glæde og lykke i vores liv.

13. Di ko sya maistorbo dahil sya ay nag-aaral pa.

14. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

15. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

16. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

17. Gusto ko na po mamanhikan bukas.

18. Malilimutin siya sa mga pangalan ng tao kaya’t lagi siyang nahihiya sa pakikisalamuha.

19. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

20. Ang pag-asa ay isang mahalagang emosyon na nagbibigay ng lakas at inspirasyon sa mga tao.

21. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

22. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

23. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

24. Kumain na kami ng tanghalian kanina.

25.

26. Lumbay na naman si Jose matapos matalo sa sabong.

27. Biglang bumangon ang hari at hinugot ang espada.

28. She was born on June 26, 1993, in Boca Raton, Florida, USA.

29. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

30. Nanghahapdi at waring nasusunog ang kanyang balat.

31. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

32. Nagbigay ng malaking tulong sa akin ang aking guro sa paghahanda sa aking thesis.

33. Football is also known as soccer in some countries, particularly in the United States.

34. If you think I'm the one who broke the vase, you're barking up the wrong tree.

35. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

36. Kailangan nating magfocus sa mga bagay na may kabuluhan at hindi sa kababawang mga bagay sa buhay.

37. Ano ho ang tingin niyo sa condo na ito?

38. Hindi ako sang-ayon sa mga patakaran na ipinatutupad ng gobyerno.

39. Esta salsa es muy picante, ten cuidado.

40. Bilang isang Kristiyano, nagbibigay ng kahalagahan sa aking buhay ang mga awiting Bukas Palad.

41. Itinago ni Luz ang libro sa aparador.

42. Subalit pinipilit pa rin niyang maging malakas bagamat talagang di na kaya ng kaniyang pang tumayo ng kahit ilang sandali man lang.

43. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

44. Di-kalayuan sa gripo ay may isang tindahan.

45. Excuse me, may I know your name please?

46. O sige, ilan pusa nyo sa bahay?

47. Hindi nakagalaw si Matesa.

48. Maraming bayani ang naging simbolo ng pag-asa at inspirasyon sa panahon ng krisis at kahirapan ng bayan.

49. The stock market can be used as a tool for generating wealth and creating long-term financial security.

50. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

Recent Searches

dietlegislationbilugangeuphoricwariisinalangcineattractive1920scriticssumamadollynagbungaterminosinunodreadersbrindarnagdaramdamtuwangexcusepanguloipinikitbaleeasierspecializeditakprobablementedisappointjaceadditionsubjectmultopshfeedbackissuesgenerabaenvironmentdingdingregularmenteflyventasecarsearmedupworkitinuringbinabainternetcestuwidiosfataldennuclearstudentpalayanexamplekapilingdifferenterrors,sameofteneditedit:mulingsupportgapdiseasesbunutanmunanakikilalangnagpapaigiblamang-lupamakitapneumonialupalopipinagdiriwangkaragatanpanalanginbintanawakasbihirarisegabrielgawingawingnapakabaitgodreadcomputere,iatflangprogrammingpagkahaporosarioinaabutanlabisnandayamagbalikartistsyearsmarurumibinabaratdalawangpagbabayadangkophanginnitongkalaunancarolstaplefeltsumabogkuboturonsurveysbefolkningensampungpayongkakayanancurtainsandamingreynasurroundingsilagayschoolanumannatitirakakayanangmaubosmatikmannaiwangbugtongmarchdeathschoolshydelbilhinbinigyangrestawanmaitimmapa,sirdistansyanagsusulatgayunmannakapapasongnagmungkahimanlalakbaymagpa-ospitalbutihingnakasuotresignationjoeibigramdamahitweddingdalawanamumukod-tangimakalaglag-pantypinagmamalakipinagkaloobannakakapagpatibaykumukuhapamilyangpumuslitjobsnakalagaynakasandignakayukomakatarungangh-hoypagngitibangladeshnariyannapanapakopanggatongbuongnaglahogumawatagaytaypilipinaspinag-aralanmagkamaligandahanyoutube,nagkasakitamericapaghalikmakauwihawaiimaibibigayrektanggulojuegosnakahugsugatangginagawapinansinnational