Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Les devises étrangères sont souvent utilisées dans les transactions internationales.

2. Nag-alala ako nang magdidilim na ang paningin ko habang nagmamaneho sa isang maulang gabi.

3. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

4. Ang magulang na mabuti, ang anak na sumusunod.

5. Ang kaniyang ngiti ay animo'y nagbibigay-liwanag sa madilim na kwarto.

6. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

7. Mon mari a fait une surprise pendant notre cérémonie de mariage.

8. Ang lolo at lola ko ay patay na.

9. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

10. Siya nama'y maglalabing-anim na.

11. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

12. He is not watching a movie tonight.

13. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

14. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

15. Work-life balance is important for maintaining overall health and wellbeing.

16. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

17. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

18. Ang kahirapan ay isang laganap na suliranin sa ating bansa.

19. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

20. Chris Hemsworth gained international recognition for his portrayal of Thor in the Marvel Cinematic Universe.

21. En invierno, muchas personas disfrutan de deportes como el esquí y el snowboard.

22. The website's search function is very effective, making it easy to find the information you need.

23. nadama niya ang bagong tuklas na lakas niyon.

24. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

25. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

26. TikTok has inspired a new wave of viral challenges, from dance routines to lip-syncing.

27. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

28. Talagang hinahangaan ni Marie ang disente nyang kasintahan.

29. Gising ka pa?! parang nabigla nyang sabi.

30. Kinuha naman nya yung isang bote dun sa lamesa kaso.

31. Siya ay nagiigib ng tubig sa banyo habang nag-aayos para sa trabaho.

32.

33. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

34. Schönen Tag noch! - Have a nice day!

35. Ang paglapastangan sa mga indibidwal at kanilang karapatan ay hindi dapat maging bahagi ng isang lipunan na may respeto.

36. Laughter is the best medicine.

37. Mas malaki ang bangka, mas malaki ang huli.

38. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

39. Marahil ay maaga kang dapat umalis upang makarating sa pupuntahan mo sa oras.

40. Hindi mapigil ang pagkakatitig niya sa pagkain na naglalaway na sa harap niya.

41. May meeting daw ang lahat ng guro kaya't kami ay maagang pinauwi.

42. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

43. She is practicing yoga for relaxation.

44. The king's royal palace is his residence and often serves as the seat of government.

45. Nahuli ng guwardiya ang magnanakaw habang ini-inspect ang kanyang bag.

46. Kucing di Indonesia juga sering dibawa ke salon kucing untuk melakukan perawatan bulu dan kesehatan mereka.

47. Ang mumura ng bilihin sa Shopee.

48. Ang Ibong Adarna ay kinikilala bilang isa sa mga pinakamahalagang kwento sa panitikang Filipino.

49. Pagod na ako, ayaw ko nang maglakad.

50. La película que vimos anoche fue una obra sublime del cine de autor.

Recent Searches

postcardnakatawagdietmamibumubulaputolbisikletamukabumabahatextoharmfulcommunitypowertradisyonitaygamesmatangayudademocraticraiseddeathpumuntapersonalbumaliknagtataesystemmungkahipumatoldustpanmusicianmalabobayabaskapeteryalibagnangyayarioftenavanceredenapalakaspareikinamataykamiashimselfbehindqualityricodulatrainingviewsambadecisionsrighthardjoytopic,tamalamangetsybumagsakanotheramountseparationtinginginstitucionesinabotmaskarachavitcnicolaryngitishearmidtermtag-arawareasmalagobroadcastingexplainmemorymakikipagsayawmastercallingbinatakbasaleepersonasalignsmamataaninvesting:hapdimagkasabayskills,nakamgaappsinabingtabamadilimpagsubokhalamangbiglabinababigkisalaskasalukuyangsultankamakalawastylebitaminawifingasugatangsasambulatnaggalaamendmentsunderholderdejaeditorpumapaligidparaangbaranggaymahahabangsparekahirapanbiyaspang-aasarnakapagreklamorocknaglaronatuwaadikmagkasakitnearlandslideabalanagmungkahiinanapakasipagaanhinutilizarawang-awaadditiondireksyontilskrivesguerreroearningmamimilinalalarofiahadtomarhiramyakapsawapatpatenglandklasetiposnagdadasalsikipamendmentpag-unladconvertidaspagkalipasmamarilnagtatrabahoreservationnathancompartenmagtagonakakatandaanjobagokahilingangearsiyentosnananaghilivelfungerendenag-poutfremtidigemarurumipambansangverdenthesepagkalapitkayanakatalungkocalambanagisingcondoamongcontinuesamparobalingzebraultimatelyhapasinnagreplykisapmata1970spananakopnagpasyapalangiti