Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "diet"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

3. Ano?! Diet?! Pero tatlong plato na yan ah.

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Eating a balanced diet can increase energy levels and improve mood.

8. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. I've been following the diet plan for a week, and so far so good.

11. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

12. Meal planning and preparation in advance can help maintain a healthy diet.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Portion control is important for maintaining a healthy diet.

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

Random Sentences

1. Bihira na siyang ngumiti.

2. He likes to read books before bed.

3. Paki-translate ito sa English.

4. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

5. Ang mga anak-pawis ay nangangailangan ng mas mataas na antas ng edukasyon upang umangat sa kanilang kalagayan.

6. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

7. The culprit behind the product recall was found to be a manufacturing defect.

8. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

9. Dalam Islam, doa yang dilakukan secara berjamaah dapat meningkatkan kebersamaan dan kekuatan jamaah.

10. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

11. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

12. Ang aming angkan ay kilala sa aming lugar dahil sa aming mga tradisyon.

13. El lienzo es la superficie más común utilizada para la pintura.

14. Mabuti pa sila, nakikita ang masayang paligid.

15. Kalaunan, pati ang tanim ng may tanim ay lihim nitong sinisira.

16. They clean the house on weekends.

17. Lucas.. sa tingin ko kelangan na niyang malaman yung totoo..

18. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

19. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

20. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

21. She attended a series of seminars on leadership and management.

22. The wedding rehearsal is a practice run for the wedding ceremony and reception.

23. Drømme kan være en kilde til inspiration og kreativitet.

24. Limitations can be overcome through perseverance, determination, and resourcefulness.

25. Det er vigtigt at huske heltenes bedrifter og lære af dem.

26. Ibinigay ng aking magulang ang kanilang buong suporta sa aking mga pangarap.

27. Hindi ho ba madilim sa kalye sa gabi?

28. We admire the courage of our soldiers who serve our country.

29. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

30. May mga nagpapaputok pa rin ng mga paputok sa hatinggabi kahit bawal na ito.

31. The singer's performance was so good that it left the audience feeling euphoric.

32. Nagtatanim siya ng mga gulay at nanghuhuli ng mga hayop sa gubat upang kanilang pagkain

33. They have been creating art together for hours.

34. He admires the athleticism of professional athletes.

35. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

36. Ang kuripot ng kanyang nanay.

37. Maging ang mga diyosa ay kanyang hinamak na wala na ngang makahihigit pa sa galing niya.

38. Mayroong kapatid na babae si Rosa.

39. Te llamaré esta noche para saber cómo estás, cuídate mucho mientras tanto.

40. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

41. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

42. Ang salarin ay gumamit ng pekeng pangalan upang makaiwas sa pagkakakilanlan.

43. Mabuti naman at bumalik na ang internet!

44. Minsan, ang mga tao ay nagigising sa gitna ng gabi at nahihirapan na makatulog muli.

45. Naniniwala ang mga Katoliko na ang mga dasal para sa mga kaluluwa sa purgatoryo ay makakatulong sa kanilang kaligtasan.

46. Las hojas de lechuga son una buena opción para una ensalada fresca.

47. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

48. Magandang ideya ang magbakasyon, datapwat kailangan ko munang mag-ipon.

49. Guten Morgen! - Good morning!

50. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

Recent Searches

butihingdietwariipapaputolnag-aalanganbilugangbankburdenpangungutyastopbumahadalandandiamondfiaexcuseresignationinantokpaamamitekstmaramibilispumuntachoicegenerosityfatalrestdidingpapuntascheduletsaasumalamaglutoiwinasiwasqualitytoolpotentialsofatiyaresponsibletrainingkaninaliablebasketbolnagagandahanmakilingverdenbumabaipinagdiriwangpakilutonakaraangnapaluhalitsonimportanteparaanspansfeedbackactivityisinaboybopolsharappuedeairplanessasamapinatirahangaringconsidermallconvey,sipadropshipping,systempneumoniaprofessionalmaglinisamazonlumagoelementarycaraballoiintayinbringingdisenyongmedgumagalaw-galawhatinggabidiaperipabibilanggonagpabotagricultoresnakakatawagobernadortabing-dagatnagkakatipun-tiponpagkabiglapinapataposmaisusuotnovellesmakatatlopaki-chargemakalipasfestivalespaga-alalamagpaliwanagkalakihanhinagud-hagodsalamangkerobangladeshsalu-salonangangahoypagkasabimakahingimahahawatreatsmensajes2001buung-buolumiwagpagkuwanaglalaroumiiyakmamalasmagpahabakumakainmalawakbrancher,nalalabingmanatilihayaangmasaktankanyasanggolmamahalinenviarumiimikpagbigyanmagagamititutolklasegumuhitanumangbinentahannodgawaingisusuotika-12napilihahahaminatamisbumitawdalangaplicarstormapadaliinhalesubject,kapwaafternoonpapayamagselossiopaoika-50pabilinagpatulongkatibayangkauntimaestratsinakusinaumabotkatagautilizanabigaelhunivarietytawapanatagmatangkaddealnaalistulangnilolokogabidustpaninspiremagsaingnewspapersspiritualfatherkriskaproductsindividualspinagkasundopagkatganidbestidapagevideobabaemaalogdaga