Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "education"

1. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

2. Different types of work require different skills, education, and training.

3. Her decision to sponsor a child’s education was seen as a charitable act.

4. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

5. Limitations can be addressed through education, advocacy, and policy changes.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Microscopes are commonly used in scientific research, medicine, and education.

8. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

9. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

10. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

11. Technology has also played a vital role in the field of education

12. Television has also had an impact on education

13. The concert raised funds for charitable causes, including education and healthcare.

14. Women have faced discrimination and barriers in many areas of life, including education and employment.

Random Sentences

1. Uuwi si Ellen sa Cebu sa Pasko.

2. We have been painting the room for hours.

3. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

4. Nagluto ako ng adobo para kina Rita.

5. Tangan ang sinipang pigi, ang buong anyo ng nakaangat niyang mukha'y larawan ng matinding sakit.

6. The wedding photographer captures important moments and memories from the wedding day.

7. Ang mga bayani ay mga taong nagsakripisyo para sa kalayaan at kabutihan ng bayan.

8. She admires the philanthropy work of the famous billionaire.

9. It's nothing. And you are? baling niya saken.

10. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

11. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

12. Kalaro ni Pedro sa tennis si Jose.

13. Pagkaraa'y nakapikit at buka ang labing nag-angat siya ng mukha.

14. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

15. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

16. We have been waiting for the train for an hour.

17. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

18. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

19. Trapik kaya naglakad na lang kami.

20. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

21. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

22. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

23. Ngunit lingid kay Roque, may namumuong lihim na pagkagusto sina Magda at Damaso sa isa't isa.

24. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng kasiyahan at kaganapan sa aking buhay.

25. Matagal akong nag stay sa library.

26. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

27. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

28. The photographer captured the essence of the pretty lady in his portrait.

29. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

30. Mahusay mag drawing si John.

31. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

32. La agricultura sostenible busca minimizar el impacto ambiental del cultivo de alimentos.

33. Para sa anak ni Consuelo ang T-shirt.

34. Sa parke, natatanaw ko ang mga tao na naglalaro at nagpapahinga sa ilalim ng mga puno.

35. The children do not misbehave in class.

36. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

37.

38. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

39. Ang mga palaisipan ay maaaring nagdudulot ng pag-unlad sa mga larangan tulad ng agham, teknolohiya, at sining.

40. Eeeehhhh! nagmamaktol pa ring sabi niya.

41. Tapos humarap sya sakin, Eh bakit ba nila ginawa yun?

42. May tatlong kuwarto ang bahay namin.

43. Ano ang dapat gawin ng pamahalaan?

44. Elektronik er en vigtig del af vores moderne livsstil.

45. Durante las vacaciones, me gusta relajarme en la playa.

46. Ano ho ang gusto ninyong bilhin?

47. Tumawa rin siya ng malakas, How's Palawan? tanong niya.

48. Sariwa pa ang nangyaring pakikipagbabag niya kay Ogor, naiisip ni Impen habang tinatalunton niya ang mabatong daan patungo sa gripo.

49. The patient's family history of high blood pressure increased his risk of developing the condition.

50. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

Similar Words

educational

Recent Searches

sikoeducationbotonapakagandangsitawmatindingmurangcriticspedroproperlycommissionhigitcolourpasswordsurgerymakilingataqueschessnutrientesfacultyincreasedaggressionmovingbringobstaclesconsiderarsiyudadiglapnamlabasmagsungitgeneratedadaptabilityulobroadcastingseparationcountlesshellofeedbackkadalaslandlineimportantenaliligodealpartynookundisasawalisriegamalilimutint-isanagkakatipun-tipontalepaki-basanatatawatumaliwasendviderebesidesmauntogdescargarqualityaksiyonkagubatanmendiolapamahalaanmangyarimalakisandwichsumamanagsusulatsingermatumalgulatnagkaganitotopicbinilhanmulamahabanegativesumusunodpagkaganda-gandaalitaptapyongsaranggolawoulddaigdigtrainingperaellenstonehamfinishedmaatimwatawatnagdaospronounkinapanayamagwadordi-kawasakanikanilangnabighaniuusapanpinag-aaralanentrancesanangmagdoorbellpopularizepagtatanimmagbalikhayaannagsuotpinasalamatannandayatumatakbokapitbahaysagutinfactorespagbabayadkilonggarbansosbihirangkaratulangsiopaopakiramdamperyahanpaglulutonatakotfollowedjulietmensemocionespaglingonbayawakbayaninghinampashatinggabibibigyanundeniablemaestraoncesinakopsinacompletamentetelaitinulosnaglulutoplanning,maibabalikkasalanankikotoygoalmejotelefonimagesnatuloglilypinagsanglaanparehonglorijacenatanggapbobomaulitniligawanfiasameexistmapenvironmentandreilingnatitiraisinakripisyoscalenakabulagtangdentistamumurapangakonakangitingpag-akyataayusinpinakamahalagangkendtemocionallasontumatawaadditionallypatibotantestoryklimapokerhigh-definitiontutoringtamarawhouseholdsunattendedmagpaniwalactricas