Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "education"

1. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

2. Different types of work require different skills, education, and training.

3. Her decision to sponsor a child’s education was seen as a charitable act.

4. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

5. Limitations can be addressed through education, advocacy, and policy changes.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Microscopes are commonly used in scientific research, medicine, and education.

8. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

9. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

10. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

11. Technology has also played a vital role in the field of education

12. Television has also had an impact on education

13. The concert raised funds for charitable causes, including education and healthcare.

14. Women have faced discrimination and barriers in many areas of life, including education and employment.

Random Sentences

1. Emphasis is the act of placing greater importance or focus on something.

2. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

3. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

4. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

5. Claro que puedo acompañarte al concierto, me encantaría.

6. Ang digmaan ay maaaring magdulot ng pagkasira ng mga kultura at tradisyon.

7. Napaangat ako ng tingin sa kanya saka tumango.

8. Sa panahon ngayon, maraming taong nagfofocus sa kababawan ng kanilang buhay kaysa sa kabuluhan.

9. You can find freelance writers who are willing to work for cheap rates, but good ones are not a dime a dozen.

10. Oh bakit nandito ka pa? ani Maico bilang tugon.

11. Hockey coaches develop game plans and strategies to help their team succeed.

12. Det er vigtigt at huske heltenes bedrifter og lære af dem.

13. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

14. Matapos ng ilang araw ito ay namulaklak.

15. Boboto ka ba sa darating na eleksyon?

16. Negative self-talk and self-blame can make feelings of frustration worse.

17. Kung hindi ngayon, kailan pa?

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. Ang paglapastangan sa mga relihiyosong simbolo ay labag sa mga patakaran ng paggalang sa iba.

20. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

21. The task of organizing the event was quite hefty, but we managed to pull it off.

22. Robusta beans are cheaper and have a more bitter taste.

23. Mabilis manakbo ang aso ni Lito.

24. I love to celebrate my birthday with family and friends.

25. Maskiner er også en vigtig del af teknologi

26. Ayaw ko ng masyadong maanghang/matamis.

27. Con permiso ¿Puedo pasar?

28. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

29. Ang amoy ng bagong simoy ng hangin ay napakarelaks at mabango sa amoy.

30. Naiinitan talaga ako, malamig ba labi mo?

31. Suot mo yan para sa party mamaya.

32. Tila nagbago ang ihip ng hangin matapos ang kanilang pag-uusap.

33. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

34. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

35. Anong klaseng kuwarto ang gusto niya?

36. Ang pamamaraan ng kasal ay nag-iiba sa iba't ibang kultura at relihiyon.

37. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

38. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

39. Napakaraming bunga ng punong ito.

40. Inakalang masama ang panahon, pero biglang sumikat ang araw.

41. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

42. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

43. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

44. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

45. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

46. Naging inspirasyon si Mabini para sa maraming Pilipino na maglingkod sa bayan.

47. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

48. Nang simula ay hindi napuputol ang komunikasyon ng magkasintahan, araw araw na sumusulat ang binata sa dalaga at ganoon din naman ang dalaga.

49. Tingnan natin ang temperatura mo.

50. Hinawakan ko siya sa may balikat niya.

Similar Words

educational

Recent Searches

marmaingmeroneducationmalikotaminnatalongiskedyulstockslistahanautomationenergipuedenbateryanasabingsonidopalapithdtvscottishmedidaparkingnagdarasalskypebilibelectoralsetyembrekaarawanhverchavitpedrokwebangbaticriticsdisappointkatabingdalawparagraphsmightabrilandamingisipdoktorsukatparisukatnapapalibutannapakalakidesigninganonglamesacarriedcampmaglalakadbroadcastbituinmagbungajeromerichmapaikotcebunathancafeteriabugtongbluesusunduinotrasamongtools,choiceideasnaglalatangcornerrelieved1982conditioningviewsmonetizingmaputimapadaliconectanelectronicideakararatingipipilitauditputaheformatwithouttopichighestmenuclienteaggressioninternalmultomalakingregularmenteprotestauniversalbulakalaklimitedsolidifyipinagbabawalhonpahahanapernanprofoundimportantpagkakatamtamankamakuwadernotigremiyerkolesstreamingrevisenagaganapproudsumahodlatestkombinationwashingtonpaglalabadapagkagustonewspapersnationalmensaheengkantadadalagangclientesannapasangpamilihanmaghahabiimagesibinigayhamakdealnilayuannagandahanhawaiipumulotkampanabumotoisaacforeverbairdpopcornibigctricasnagdaramdamlibraryallottedrabemabilisreadersyuntoothbrushkerbwalisnakikilalangnanghahapdikinatatalungkuangnagkitakalalakihantabing-dagatbiocombustiblespinakamaartengkayang-kayangnapakaselososupremejennymakangitimakitakapangyarihangvirksomhederkagalakannaka-smirknakakasamaobra-maestrapagkamanghanapakahusaynakapapasongnagulatmalezanagkakakainnagbakasyontinatawaglibronangangaralsiniyasatmasayahininaabutaniwinasiwasnagtataasmensajeskagandahaninirapannakasahodnagpuyosgulatnagsagawa