Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "tomorrow"

1. Bis morgen! - See you tomorrow!

2. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

3. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

4. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

Random Sentences

1. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

2. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

3. Dalawa ang kalan sa bahay namin.

4. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

5. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

6. The children eagerly lined up for their share of the birthday cake.

7. Les sciences de la Terre étudient la composition et les processus de la Terre.

8. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

9. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

10. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

11. Ailments can be managed through self-care practices, such as meditation or physical therapy.

12.

13. We should have painted the house last year, but better late than never.

14. Tumayo na ko tapos pumasok sa kwarto ko.

15. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Mababa ang tubig sa ilog dahil sa tag-init.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. They may draft and introduce bills or resolutions to address specific concerns or promote change.

20. There are a lot of books on the shelf that I want to read.

21. Hindi ko alam kung paano maaalis ang aking mga agam-agam sa aking kinabukasan.

22. Winning the championship left the team feeling euphoric.

23. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

24. Ano ang ikinatatakot ng mga tao sa bagyo?

25. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

26. Offering forgiveness doesn't mean we have to continue a relationship with someone who has repeatedly hurt us; setting boundaries is important for self-care.

27. Børn har brug for at lære at samarbejde og kommunikere med andre.

28. Sigurado ka? Hala! Mag-order ka rin ng burger at fries!

29. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

30. Ang pagbasa ng magandang libro ay isang nakagagamot na paraan upang maibsan ang stress.

31. Ang haba ng prusisyon.

32. The singer on stage was a beautiful lady with an incredible voice.

33. Las comidas calientes y reconfortantes, como sopas y guisos, son populares en invierno.

34. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

35. Sa takipsilim naglalakad ang matanda sa tabing-dagat.

36. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

37. Hindi ako usually ganto, pero sana pwede ba kita makilala?

38. Boboto ka ba sa darating na eleksyon?

39. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

40. Ibinigay ko ang lahat ng aking lakas at determinasyon upang makamit ang aking mga layunin.

41. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

42. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

43. The novel was a hefty read, with over 800 pages.

44. There are a lot of benefits to exercising regularly.

45. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

46. Hindi ako sang-ayon sa mga patakaran na ipinatutupad ng gobyerno.

47. Matumal ang mga paninda ngayong lockdown.

48. H-hindi na sabi eh! inis na sabi nya.

49. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

50. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

Recent Searches

tomorrowbobotolinenatanongnapakahatinggabilaganapmetodisknapadpadbinentahaniconburdengreenmalinisbumababajacemanirahanipinatawaginiindadispositivotindakulungankumalmamagbibiladpagkabiglanakapasade-latarimaschristmassuriinbahagyangnagkakasyaremainmayroonomgmrsonlinenapahintopasaherotaga-ochandointramurosmagagamitkahaponkinauupuangcosechar,papalapitipinauutangbumaligtadhagdananpumupuntapangprusisyonpapuntangpanitikanpaki-basapagtingin1980bagostillleonyalayasnakakapamasyalsundhedspleje,gumagalaw-galawnatigilannararapatobra-maestramoviesnakagalawmedya-agwawritenapuputolnapatungonapatakbobinibiyayaannagandahankinikilalangeskwelahanalikabukinnapasobranakatulognakapasoknakaangatnaiinitanpambansangpupuntahannageespadahanrebolusyoninirapannagtalagakinakabahanmahiwaganaabutannalugmokfilipinanagmistulangnagsimulabighanitinikmanrespektiveiligtaspasasalamatnagpagawanagkikitanag-aaralnabighaniminamahalmatitigasmalungkotmahihirapk-dramamagpahabanapadaannaiwangkapalrobinhoodabutankinainmag-uusapiconsyarinyantiniknoonghastaiigibmag-ingatsayawanenergymag-asawakuwadernosasabihinsakinkumaripasku-kwentakarapatankaramihankapatagankandidatokalakingpumatolsayumiyaklumulusobkaloobangyataimagingkakataposyourbilerfonovedenvironmentcontinuecomputereeviliparatingjunioplanintroducehimihiyawhalamanangatheringemocionaledukasyondisyembremagagandangdinaluhannagbentacigarettenakuhangchumochostinulak-tulakbutterflyalas-tresyumabangtinangkanagpuntahantagumpaystrategystarted:nagpepekesinasabisensiblepropesorprofoundpinansinpinakainphysicalpersonasgatolunanpangalanangelastomangingisdaupopamasahepalengke