Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "tomorrow"

1. Bis morgen! - See you tomorrow!

2. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

3. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

4. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

Random Sentences

1. Maghilamos ka muna!

2. Pinagkakaguluhan lamang tayo ng mga tao rito ay wala namang nangyayari.

3. Puti ang kulay ng pinto ng pamilyang Gasmen.

4. Some of her most famous songs include "No Tears Left to Cry," "Thank U, Next," "7 Rings," and "Positions."

5. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

6. Hindi siya nakapagpahinga ng maayos kagabi, samakatuwid, inaantok siya ngayon sa klase.

7. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

8. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

9. Bite the bullet

10. Napapatungo na laamang siya.

11. Malaki at maganda ang bahay ng kaibigan ko.

12. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

13. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

14. Me gusta mucho dibujar y pintar como pasatiempo.

15. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

16. Ang masakit na alaala ay patuloy na nagpapalala sa kanyang hinagpis.

17. Exercise can be tough, but remember: no pain, no gain.

18. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

19. Nagulat si Mang Kandoy sapagkat ang kulay ng dugo ng tigre ay abo.

20. En la realidad, hay muchas perspectivas diferentes de un mismo tema.

21. Get your act together

22. Pangkaraniwang Araw sa Buhay ng Isang Tao

23. Sarado ang eskuwela sa Sabado at Linggo.

24. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

25. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

26. Ilang araw ang reservation natin sa hotel?

27. "Dogs are not our whole life, but they make our lives whole."

28. Mabango ang mga bulaklak sa sala.

29. Kapag mahangin, inililipad nito ang mga dahon palayo sa halamanan.

30. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

31. At blive kvinde handler også om at finde sin egen stil og identitet.

32. Drømme kan være små eller store, men alle er vigtige.

33. Nakangiti sya habang nakatayo ako at nagtataka.

34. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

35. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

36. Cryptocurrency is often subject to hacking and cyber attacks.

37. Maluwag ang parisukat na sementong kinatitirikan ng gripo at ang dulo ng pila'y nasa labas pa niyon.

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. Software er også en vigtig del af teknologi

40. Babalik ako sa susunod na taon.

41. Gising ka pa?! parang nabigla nyang sabi.

42. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

43. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

44. I am absolutely determined to achieve my goals.

45. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

46. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

47. A lot of birds were chirping in the trees, signaling the start of spring.

48. Einstein's work also helped to establish the field of quantum mechanics.

49. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

50. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

Recent Searches

tomorrowentertainmentmarieganunnatabunannagsilapitibinigaytumalonmanilbihanmaglaroincluirkampeonna-funddyipnikinalakihancrazymeronuntimelycapacidadgardenyourself,linawmabaitteacherkalongkumbentolayawromanticismokaharianlabahinpaghaharutannaglokotagaytaynakatulogambisyosangairportforskel,ricaisasabadallemaramotaustraliapnilitindependentlytiboknagplayutilizanasahankatagangnatutuwakatandaanbinasacasamustmedidawarinuhnapatinginmalambingkongkasopakilutonicemenosanimoybecomearghjoshmeaningbegandulotremainexcusesolararbejderkasyapyestaimaginationhanlackkamatisestablishabonoseekorasasulcontestakingbroadcastcommerciallikelybeginningtipiddulahalikaeyefatalpinunititimmulti-billionabstainingelectionhighestwithoutclockinternaconsiderayanonlyrecentthoughtsnaggingclientessiguronamulatkwenta-kwentavitaminsnanlilisikt-shirtpresidentenakabluenakitapagimbaynagpapaigibtagpiangpisarakaraniwang3hrsanongtengalorenamaghandacompositorespulisdollariilanbaropusonabahalapisinakapagngangalitnagtatakabahaynungatensyongnapasigawtheypinagawamanahimikmagkakaanaknagawangnabalitaanmadungisnagbibirotahananpaninigasnakaakyatbilihinbarcelonaorganizepasensyamarketplacespakealampancitsetyembredisappointcigarettevehiclesmasungitstylesshiftsecarseparaisoumakbaytumiranailigtasistasyonmasyadongkumakantakissumuwisinasabimontreallumalangoytalinonatitiyakjeepneysubject,kapataganpigilanattorneynglalabasinodiferentespinagalitancultivonagpakitanagpapasasamaglalakadrevolucionado