Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "party"

1. A lot of time and effort went into planning the party.

2. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

3. Every year, I have a big party for my birthday.

4. Hiram na kasuotan ang ginamit niya para sa theme party.

5. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

6. My co-workers organized a surprise birthday party for me at the office.

7. My coworkers threw me a surprise party and sang "happy birthday" to me.

8. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

9. Party ni Lory? nabigla sya sakin sa sinabi ko.

10. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

11. She spilled the beans about the surprise party and ruined the whole thing.

12. Sino ang mga pumunta sa party mo?

13. Sino-sino ang mga pumunta sa party mo?

14. Suot mo yan para sa party mamaya.

15. The cake was a hit at the party, and everyone asked for the recipe.

16. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

17. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

18. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

19. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

20. To break the ice at a party, I like to start a game or activity that everyone can participate in.

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Mahalagang maging totoo sa ating mga sarili at sa mga taong nakapaligid sa atin, datapapwat ay may mga pagkakataon na tinatago natin ang ating mga tunay na damdamin.

3. Different types of work require different skills, education, and training.

4. Ano ang nasa bag ni Cynthia?

5. Tulala lang rin yung daddy niya sa amin.

6. Ano ang ginagawa mo nang nagkasunog?

7. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

8. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

9. Mahalagang magkaroon ng tamang perspektiba upang maipakita ang tamang reaksyon sa pangamba.

10. I know you're going through a tough time, but just hang in there - you're not alone.

11. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

12. I just launched my new website, and I'm excited to see how it performs.

13. Natawa nanaman sya, Hindi, maganda sya.

14. Late ako kasi nasira ang kotse ko.

15. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

16. Ok. Alam mo, isa pa yung excited na magka-apo eh.

17. She has excellent credit and is eligible for a low-interest loan.

18. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

19. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

20. Napatayo si Magda sa bangka, dahil alam niyang hindi marunong lumangoy ang dalawang bata.

21. Beauty is in the eye of the beholder.

22. The team’s momentum shifted after a key player scored a goal.

23. The concert raised funds for charitable causes, including education and healthcare.

24. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

25. Nakita ko ang mga kapatid ko noong pasko.

26. Nakabili na sila ng bagong bahay.

27. Kucing di Indonesia sering dimanjakan dengan mainan seperti bola karet atau mainan berbentuk tikus.

28. Mahalaga ang pagtitiyaga sa bawat bagay na ating ginagawa, datapapwat ay may mga pagkakataon na hindi natin nakukuha ang inaasahan nating resulta.

29. Kinagabihan, wala si Pinang sa bahay.

30. All these years, I have been creating memories that will last a lifetime.

31. Magandang maganda ang Pilipinas.

32. He has been repairing the car for hours.

33. Nangagsipagkantahan kami sa karaoke bar.

34. Nagdala si Butch ng laruan para sa bata.

35. Las escuelas públicas son financiadas por el estado y son gratuitas para los estudiantes.

36. Walang password ang wifi ng kapit-bahay.

37. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

38. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

39. Kinabukasan ay nag paalam ulit si Ana na aalis pagtungo sa kagubatan, dahil tinawag daw siya ulit ng nagbigay ng pagkain sa kaniya.

40. Sa bawat kumpetisyon, ipinapakita ni Carlos Yulo ang kahusayan at disiplina ng isang atletang Pilipino.

41. Tantangan hidup adalah kesempatan untuk belajar, tumbuh, dan mengembangkan ketahanan diri.

42. Bumagsak ang nawalan ng panimbang na si Ogor.

43. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

44. Hindi pa nga ako nagtatanghalian eh.

45. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

46. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

47. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

48. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

49. Gaano ka kadalas uminom ng bitamina?

50. He is watching a movie at home.

Similar Words

two-party

Recent Searches

partybangcivilizationbecomingwordnagawa4thapoyoveralllinawmalihisnogensindewastemaistorbomagdaanbestida00amiikliblazinghinigitbevarebinilhanbuenawashingtonrichsparkdevelopedipagamotwordsmemorialconectadosniliniskotsemangnagyayangmakalingnakapamintanamahinogskyldesmarahasnagpakilalamasamangnatatawangmiraitinatapatlimahant-isabundokagesaidnami-misspracticadojannyopagbubuhatanpagdatingnabagalankaragatanchangemapakalirefersbinabaanfacebookstevepersonalpagepitakalayout,addsedentaryenforcingmoreborndinaddressdragoncontroversynanlilimahiddistansyamakalaglag-pantysakimincludeusingawarecomunicarsecreatingreallyanimthereroquenakapagproposepakikipaglabantumatakbonapasubsobmagtagoasignaturaartistpagsagotpagtawatumagalmagpaliwanagnasasabihantobaccotiniradorpaga-alalanagpapaigibkalakitinakasanawtoritadongstrategiesmagdoorbellmorningleksiyonmagkakaroonsacrificenuonbatilegendscupidbisigresignationpinatidfurbitiwanjuegosnagbibigayanbilibidtsismosadiferenteslungsodempresastelebisyonlumusobandreacaraballobook,undeniabledescargarvitaminbintanakinakainmaramotbunutanbawatmahigpitnangingitngitretirarsocietyresearch,kawalgymnilapitancocktailnatitiratayolayuanmaibabaliktatlopawiskumatokmaibalikkatagalanasiaticlilytulalakenjisapatcomputere,krusnicomaulitlumilingonplasahappenedkelanpagpasoksabogmakatawaluluwasinilalabasbrucekabutihanlabahinhulihanmagsayangpinakamatabangsinipangi-rechargetinigheynagkakamalimississippitoolsiikotnagsusulputansiembranagpapantalkoronaunodroga