Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "skills"

1. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

4. Different types of work require different skills, education, and training.

5. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7. Fathers can also play an important role in teaching life skills and values to their children.

8. Football players must have good ball control, as well as strong kicking and passing skills.

9. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

10. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

11. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

12. He has improved his English skills.

13. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

14. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

15. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

16. I am absolutely impressed by your talent and skills.

17. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

18. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

19. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

20. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

21. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

22. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

23. Mathematics helps develop critical thinking and problem-solving skills.

24. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

25. She admires her mentor's leadership skills and work ethic.

26. The team captain is admired by his teammates for his motivational skills.

27. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

28. This can be a great way to leverage your skills and turn your passion into a full-time income

29. Time management skills are important for balancing work responsibilities and personal life.

Random Sentences

1. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

2. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

3. They do not skip their breakfast.

4. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

5. May pitong taon na si Kano.

6. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

7. Aray! nagcurve ball sya sa sakit sa sahig.

8. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

9. We celebrated their promotion with a champagne toast and a slice of cake.

10. Di ko inakalang sisikat ka.

11. Boboto ka ba sa darating na eleksyon?

12. Users can create and customize their profile on Twitter, including a profile picture and bio.

13. Si Emilio Aguinaldo ang unang pangulo ng Republika ng Pilipinas.

14. Nasaan ba ang pangulo?

15. Saka dalawang hotdog na rin Miss. si Maico.

16. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

17. Patawarin niyo po ako, nagpadala ako sa mga pagsubok.

18. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

19. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

20.

21. Sa gitna ng tagtuyot, ang mga magsasaka ay nagiigib mula sa ilog para sa kanilang mga pananim.

22. Es importante limpiar y desinfectar las heridas para prevenir infecciones.

23. Nagsasama-sama ang mga Pinoy tuwing Pasko para magdiwang.

24. Twinkle, twinkle, little star.

25. Ibinili nya ng maraming diaper ang kanyang anak.

26. Madali ka nitong bibigyan ng paninda kung may sarili kang bangkang paghahanguan ng mga huling isda sa karagatan.

27. Like a diamond in the sky.

28. Wag ka naman ganyan. Jacky---

29. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

30. Bakit sumakit ang tiyan ni Tonyo?

31. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

32. Sa harap ng mga bisita, ipinakita niya ang magalang na asal ng mga kabataan sa kanilang pamilya.

33. ¿Me puedes explicar esto?

34. Agad silang nagpunta kay Tandang Isko, ang arbularyo sa katabing bayan.

35. Wala siyang sapat na budget, samakatuwid, hindi niya mabibili ang gustong cellphone.

36. Naibaba niya ang nakataas na kamay.

37. Ang kaulayaw ay mahalagang bahagi ng buhay ng isang tao.

38. They are building a sandcastle on the beach.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

41. Ang pagpapatingin sa dentista ay hindi lamang para sa kalusugan ng ngipin, kundi para na rin sa kabuuan ng kalusugan ng katawan.

42. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

43. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

44. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

45. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

46. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

47. The journalist interviewed a series of experts for her investigative report.

48. Ano ka ba. Mas mahalaga ka naman sa dota noh.

49. Kung wala kang pera umalis ka na dyan at baka hindi ako makapagpigil sa iyo.

50. Puwede bang makausap si Maria?

Similar Words

skills,

Recent Searches

skillspagmasdanlalargakapwacynthiaumokayincitamenterpagsahodlumbaylilipadvegasandreaipinambilipanatagnangingilidpayapangbiglaanpinisilnapadpadtirangpnilitsagotannikamarielnanoodlaamangkakayananninalinabibilhintataasbunutanmaghatinggabithroatkumpunihinwinsbooksfiverrtigasangelakunwaadecuadotiyannapakopalapagkakayananglipadhomemulighederdefinitivonataposbalatsiglohikingsacrificefatherplagaspalakapublishing,mangemalayangmapahamakmaaariairconfilmsayokoroselletalentmalamangmagkasinggandameronsuccessfuldiagnosticmaluwangclientsiatfklasrumfionapunsoresortaudiencecomputere,casagoshrightsagaparaoutlinesguardatenderlasingeroroonparagraphsmaitimtakesestardollycommunitypanguloconventionalprivatecomplicatedbinabaanbumugaisabrucebalebuwalsorryipinikitpinilinghatingmind:darkarmedipapainitdulamapapaoftereportlorenapollutionpartnerincludeprogramaleadsequeedit:differentrepresentativeconditionheftysmallconstitutionprovidedbowsabadongnakapagsabinagtutulakpagpapatubomagkahawakbaku-bakongagilamaramotmalilimutanmadadalatherapeuticslumutangngumingisikinalalagyantilitatlomaibabalikbanlagkainaninventadoatensyonsumimangotsadyang1960sgabipersonmatikmaninastashowerbagalpinatirapakisabirestawrananabumilibestidaiconsspeechesaffiliatedissenahulisalatmalikottambayancarmenhundredfrescodailyformsmagtipidilawilocosdaladalagoodeveningnunogatherbotanteindustrypanotapewalongindiapatistar