Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "skills"

1. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

4. Different types of work require different skills, education, and training.

5. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7. Fathers can also play an important role in teaching life skills and values to their children.

8. Football players must have good ball control, as well as strong kicking and passing skills.

9. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

10. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

11. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

12. He has improved his English skills.

13. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

14. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

15. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

16. I am absolutely impressed by your talent and skills.

17. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

18. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

19. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

20. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

21. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

22. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

23. Mathematics helps develop critical thinking and problem-solving skills.

24. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

25. She admires her mentor's leadership skills and work ethic.

26. The team captain is admired by his teammates for his motivational skills.

27. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

28. This can be a great way to leverage your skills and turn your passion into a full-time income

29. Time management skills are important for balancing work responsibilities and personal life.

Random Sentences

1. May grupo ng aktibista sa EDSA.

2. Mag-uusap kami sa makalawa ng tanghali.

3. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

4. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

5. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

6. Hindi dapat mawala ang kalayaan sa pagpili ng ating sariling relihiyon at pananampalataya.

7. She is playing with her pet dog.

8. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

9. We sang "happy birthday" to my grandma and helped her blow out the candles.

10. Salamat ha. aniya bago ako makapasok sa kwarto.

11. They have renovated their kitchen.

12. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

13. Kinaumagahan ay wala na sa bahay nina Mang Kandoy si Rabona.

14. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

15. Nagitla ako nang biglang nag-ring ang telepono ng madaling-araw.

16. He has painted the entire house.

17. Up above the world so high,

18. Hanggang maubos ang ubo.

19. Pepes adalah makanan yang terbuat dari ikan atau daging yang dibungkus dengan daun pisang dan dimasak dengan rempah-rempah.

20. Pinakain ni Fia ang aso ng dog treats.

21. Di rin ako paulit-ulit ha! Di yan ang lagi kong sagot!

22. Las bebidas calientes, como el chocolate caliente o el café, son reconfortantes en el invierno.

23. Kapitbahay ni Armael si Juang malilimutin.

24. The photographer captured a series of images depicting the changing seasons.

25. Mabuti pang umiwas.

26. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng kaguluhan at kalituhan.

27. Ang bawa't isa ay may kanya-kanyang ginagawa.

28. Apa kabar? - How are you?

29. Gaano kalaki ang bahay ni Erap?

30. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

33. But in most cases, TV watching is a passive thing.

34. Nang biglang lumindol at nawala ang matabang babae, isang diwatang ubod ng ganda ang lumitaw sa harap niya.

35. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

36. Mamimili si Aling Marta.

37. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

38. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

39. Gusto niya ng magagandang tanawin.

40. mga yun. Ang mahalaga ay makapagempake ako agad.

41. You're not being direct. Stop beating around the bush and just say it.

42. Maputi si Kano, kaya ganito ang tawag dito sa kanilang pook.

43. Ano pa ho ang pinagkakaabalahan ninyo?

44. Napakahusay na doktor ni Jose Rizal.

45. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

46. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

47. I forgot your birthday, but here's a card anyway. Better late than never, right?

48. Magkaiba ang disenyo ng sapatos

49. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

50. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

Similar Words

skills,

Recent Searches

skillshirammaynilanaghubadininompahabolbinitiwanmagpakaramimaestraninyongtusongkanayangnagpasanestadosmaghapongbanalmaluwaggawingunangmulsenateanungpinoyhuertoninamatulunginbantulotrenaiakataganglilikovegassongsinihandasarabangkomalikotsundaenasanherramientamagbigayaninalagaanheartbreaktokyokumampiiwasantatayohigh-definitionsigurobinibilangikawnegosyoninyothroatlaruanpinagkasamamataaselenamatipunoganitogrammarreachbingoinulitseniorpriestbasahinpasigawsonidomalayangbumabagfuesnobritoreboundcenteriguhitkadaratingmassesnagbasamaariredigeringjackyalamadverselydemocraticwidereducedtontryghedcommunityknownmesangscaledayyoungmabutingharimillionslaylayteachuriideyasamuumiinitputingbituinefficientpublishedleadtopichigheststructureipinalutomitigategapayanspendingpagsubokawaresteerslaveimpacteddinalaimprovestylesstudentsadditionallysumapitthereforechambersnagpuntaextrabardisensyomarahaspinagmamalakijuegosdesisyonanrangepdadawmultogabinghawaiinilaosasiatickunwareportbabamagulayawinabutangotnagkabunganakauslinginiibigibiglimitisasabadipinatawagtinutopmanilbihankontrakutsaritangkaybilisteacherbultu-bultongcigarettesinalokprosperannaallkadalasjagiyamapuputipapagalitanpagpapasannagsisigawnakakasamamag-plantpagkakalutosalu-salonakagalawkasaganaanjocelynsoundrenatofulfillingtuvolimitednataposkatagalanandresbalatnanghihinamadkakuwentuhanmagkahawakmaipantawid-gutomstep-by-steprebolusyon