Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "skills"

1. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

4. Different types of work require different skills, education, and training.

5. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7. Fathers can also play an important role in teaching life skills and values to their children.

8. Football players must have good ball control, as well as strong kicking and passing skills.

9. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

10. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

11. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

12. He has improved his English skills.

13. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

14. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

15. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

16. I am absolutely impressed by your talent and skills.

17. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

18. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

19. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

20. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

21. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

22. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

23. Mathematics helps develop critical thinking and problem-solving skills.

24. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

25. She admires her mentor's leadership skills and work ethic.

26. The team captain is admired by his teammates for his motivational skills.

27. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

28. This can be a great way to leverage your skills and turn your passion into a full-time income

29. Time management skills are important for balancing work responsibilities and personal life.

Random Sentences

1. Di ka galit? malambing na sabi ko.

2. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

3. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

4. Einstein was known for his sense of humor and his love of sailing.

5. Un powerbank es un dispositivo portátil que permite cargar dispositivos electrónicos.

6. Mahal ang mga bilihin sa Singapore.

7. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

8. Ang aming angkan ay mayroong mga natatanging tula at awitin.

9. Pagkatapos ng ilang taon, nagulat siya nang makasalubong niya ang dating kaklase na matagal na niyang nakalimutan.

10. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

11. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

12. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

13. Ang kalayaan ay hindi lamang tungkol sa pagiging malaya sa pagpapahayag ng ating mga saloobin, ito rin ay tungkol sa pagpili ng ating mga sariling desisyon at pagpapasya sa ating buhay.

14. Lord, Wag mo muna siyang kunin..

15. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

16. Kaya't pinabayaan na lang niya ang kanyang anak.

17. Hindi siya maramot sa pagbibigay ng kanyang mga lumang damit sa mga nangangailangan.

18. Baby fever can affect people of various ages, backgrounds, and genders.

19. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

20. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

21.

22. Ang paggamit ng droga ay maaaring magdulot ng pagkabaliw, paranoia, pagkabalisa, at pagkakaroon ng kawalan ng pag-iingat sa sarili.

23. Sa buwan ng Mayo ang kaarawan ko.

24. Gusto ko sanang makabili ng bahay.

25. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

26. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

27. Kasingganda ng rosas ang orkidyas.

28. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

29. Kapitbahay ni Armael si Juang malilimutin.

30. Ha? Anong konek ng gas sa taong nagugutom?

31. Malungkot ka ba na aalis na ako?

32. The internet is full of fashion blogs. They're a dime a dozen.

33. Ano ang pinakidala mo kay Sarita sa Maynila?

34. Me duele el estómago. (My stomach hurts.)

35. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

36. Schönen Tag noch! - Have a nice day!

37. The invention of the telephone led to the creation of the first radio dramas and comedies

38. Ano ang nangyari sa Compostela Valley?

39. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. Robusta beans are cheaper and have a more bitter taste.

42. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

43. Halos anim na oras silang naglakad paakyat ng bundok makiling.

44. Limitations can be overcome through perseverance, determination, and resourcefulness.

45. Bigla nya akong binato ng unan, H-hoy! Magtigil ka nga!

46. Si Jose Rizal ay pinagpalaluan ng mga Pilipino bilang bayani ng bansa.

47. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

48. Siya ay mayabang at masyadong malaki ang pagkakilala sa sarili

49. Mahalagang magkaroon ng financial literacy upang malaman kung paano ma-manage ang mga utang.

50. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

Similar Words

skills,

Recent Searches

skillsmiyerkulesisamalalakibangapapalapitactorsinunggabanemphasizednagitlaroselleideamabaitbroadcastjosiesolidifypupuntanilolokomartaimportantesoftenmalagoulosciencepracticadouriangkingmatutongnegro-slaveslayuanninanaisdumiretsoilawnakaraanmakilalatrafficrawewanmasayanag-aaralitinatagngakanomasyadokastilangcharitabledumagundongfuncionesumanomataespecializadastuwingfidelsikmuralumiitbakerightmonetizingtsaatogetherplayednagbabalalifetugonrebolusyonpagapangaplicarpoliticsdinipunung-punoadvertising,ano-anomagbasapagtatanonglorysusunodulamlatedilakasiyahanlakadkapatawaranhitpoottinitindasumpabutasanicedulatuladgngmakitalapatoutdinanasmauntogdagatwonderopdeltownabangankaysatakepalaynakangitingsiyanglittlebutiimpactpananakotposporokidlatmalulungkotfreelancing:allowedabstaininglaganapfertilizerkasoautomatiskninyocolourhaponnasabibrieforasanmabilisdemnagtataasnaglahongguroalintuntuninnayonnabitawansonidosaan-saandreamsmagbigayanadvancementsnangyaripasahekindlemorepleasepamasahetungkolyatakailanmanmalungkotphilosophydietinaaminlumakituluyangodnakapamintanagloriadressmabangoshenandoontrinabundokfloorcultivationnakabalikhehekinuskoshalagamagpaniwalagigisingubuhinkayanaliwanagandinalaweachboxingmejopinakainlunetaamendmentkarapatangcramenakakunot-noongdownjanmabalikhorseipinambilimakapalbiglaanconclusionhumigit-kumulangonehimutokgustongnabubuhaynapuyatsystemmarahas