Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "skills"

1. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

4. Different types of work require different skills, education, and training.

5. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7. Fathers can also play an important role in teaching life skills and values to their children.

8. Football players must have good ball control, as well as strong kicking and passing skills.

9. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

10. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

11. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

12. He has improved his English skills.

13. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

14. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

15. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

16. I am absolutely impressed by your talent and skills.

17. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

18. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

19. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

20. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

21. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

22. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

23. Mathematics helps develop critical thinking and problem-solving skills.

24. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

25. She admires her mentor's leadership skills and work ethic.

26. The team captain is admired by his teammates for his motivational skills.

27. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

28. This can be a great way to leverage your skills and turn your passion into a full-time income

29. Time management skills are important for balancing work responsibilities and personal life.

Random Sentences

1. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

2. Hinampas niya ng hinampas ng kidkiran ang binatilyong apo.

3. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

4. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

5.

6. Nakumbinsi niya ang mga ibon at siya ay isinama sa kanilang pagdiriwang.

7. Kapitbahay ni Armael si Juang malilimutin.

8. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

9. Ang tagtuyot ay nagdulot ng malawakang pagkamatay ng mga alagang hayop.

10. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

11. Nang mag-asawa ang mga kapatid ni Psyche, humingi siya ng payo kay Apollo kung sino ang dapat mapangasawa niya.

12. Tumawa rin siya ng malakas, How's Palawan? tanong niya.

13. Nagkapilat ako dahil malalim ang sugat ko.

14. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

15. Online traffic to the website increased significantly after the promotional campaign.

16. Ginamit nya sa pangungusap ang mga sumusunod na salita.

17. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

18. Taksi ang sasakyan ko papuntang airport.

19. Sa lilim ng kanyang sombrero, tahimik na nagmamasid si Lola habang binabaybay namin ang kalsada.

20. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

21. Nagsimula ang programa sa dakong huli ng gabi.

22. Hindi ko alam kung kakayanin mo ako, pero sana pwede ba kitang mahalin?

23. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

24. Nagluto ako ng adobo para kina Rita.

25. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

26. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

27. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

28. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

29. Las personas que fuman tienen más probabilidades de sufrir de tos crónica.

30. Mi amigo es un excelente cocinero y siempre me invita a cenar en su casa.

31. Tango lang ang sinagot ni Mica. Bumaling sa akin si Maico.

32. Saan ako nag-aaral ng kindergarten?

33. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

34. Medarbejdere kan blive tildelt forskellige arbejdstider, som natarbejde.

35. Tuwang-tuwa pa siyang humalakhak.

36. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

37. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

38. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

39. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

40. Bawal ang maingay sa library.

41. The United States has a complex political system, with multiple levels of government and political parties.

42. Put all your eggs in one basket

43. Walang konsyerto sa plasa mamayang gabi.

44. Ibinigay ko ang aking tulong sa mga naghihirap upang masiguro ang kanilang kaligtasan.

45. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

46. A couple of hours passed by as I got lost in a good book.

47. Sampai jumpa nanti. - See you later.

48. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

49. Women make up roughly half of the world's population.

50. I've been taking care of my health, and so far so good.

Similar Words

skills,

Recent Searches

skillsremembertumatawagbinanggadiaperonetuluyanmasayang-masayanghugisctilesdollarumabogpinakamahabanangtanggapinpagawainquezonmuchayelolugawalas-tresmethodsinlovepinag-aralandadmansanaymaligayapalengkehiyacontinuesputolaanhinresearch:knowsmaligowritenagitlalihimbakurantangingsumigawmatunawmaistorboreleasedmagkapatidsalamatawaregalawhayopestudiopagsasayasundaenahulogconvertidasnag-aaralcultivatednandayalumilipadhudyatmagsugalmakapangyarihanghasalmusalsalitaflavioparusahansaantrycyclekaninoconectanbantulotku-kwentafeelinuulcerdreamsnagmistulangvibratebiggesttinikmanlandasdraft:visualsuriincandidatesngakasodawgubatbateryaitinalagangalas-dosdisenyongniyakapsilyapag-alagahalagakasamaparayanchoisofalagingimposiblemakahihigitaniyabecomescarbonsellpedesapilitangundasnakiramayyourself,balikatmakainpagsahodearntamadeclarewarimotionnamulamagtatampomagsasakaraiseshinesmaynilaatlibobingibingoblusangseveralpageantbusilakeksempelsandwichhayaanggutompapasokapatnabigkaspondo10thhatenakaraanpagengitifuncionarmaka-alisnagliliwanagmantikasonnakapilakumpunihinipanghampastingmagtanimdinalananghahapdipatiano-anohinugotsumpainnalungkothaponartificialbusnazarenomakalingmensaheminerviebillkinabubuhayclipownanungmagsi-skiingemphasiskongmamalasyamansamemaya-mayamalalakidilakatuladpotentiallinamatagalnanaogpalawanelijemaggusalilagaslascontestitinatapatlapatvalley