Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "skills"

1. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

4. Different types of work require different skills, education, and training.

5. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7. Fathers can also play an important role in teaching life skills and values to their children.

8. Football players must have good ball control, as well as strong kicking and passing skills.

9. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

10. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

11. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

12. He has improved his English skills.

13. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

14. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

15. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

16. I am absolutely impressed by your talent and skills.

17. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

18. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

19. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

20. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

21. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

22. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

23. Mathematics helps develop critical thinking and problem-solving skills.

24. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

25. She admires her mentor's leadership skills and work ethic.

26. The team captain is admired by his teammates for his motivational skills.

27. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

28. This can be a great way to leverage your skills and turn your passion into a full-time income

29. Time management skills are important for balancing work responsibilities and personal life.

Random Sentences

1. Nagtagumpay siya sa kanyang agaw-buhay na laban sa kanyang sakit.

2. J'ai acheté un nouveau sac à main aujourd'hui.

3. Madalas lasing si itay.

4. Limiting the consumption of processed foods and added sugars can improve overall health.

5. Nang malamang hindi ako makakapunta sa pangarap kong bakasyon, naglabas ako ng malalim na himutok.

6. No me gusta el picante, ¿tienes algo más suave?

7. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

8. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

9. Sa purgatoryo, inaalis ng Diyos ang mga natitirang kasalanan sa mga kaluluwa bago sila tanggapin sa Kanyang harapan.

10. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

11. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

12. The laptop's hefty price tag reflected its powerful specifications and high-end features.

13. May malawak na lupain ang kanyang mga magulang.

14. Nakatapos na ako ng thesis kaya masayang-masaya ako ngayon.

15. Ang pagtulog ay isang likas na gawain na kinakailangan ng bawat tao para sa kanilang kalusugan.

16. Tweets are limited to 280 characters, promoting concise and direct communication.

17. La música clásica es una forma de música que ha existido durante siglos.

18. Pakukuluan ko nang apat na oras. Ikaw?

19. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

20. Sumimangot siya bigla. Hinde ako magpapapagod.. Pramis.

21. Their primary responsibility is to voice the opinions and needs of their constituents.

22. Ang daming kuto ng batang yon.

23. Alam mo naman na mabait si Athena, di ba?

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. She does not use her phone while driving.

26. Wag kang magtatanim ng sama ng loob sa kapwa.

27. Ang kalawakan ay punung-puno ng mga bituin.

28. Hindi siya makapaniwala kaya sinalat niya ang kanyang mukha.

29. nakita niya ang naghuhumindig na anyo ni Ogor.

30. However, there are also concerns about the impact of technology on society

31. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

32. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

33. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

34. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

35. Luluwas ako sa Maynila sa Biyernes.

36. Les élèves doivent travailler dur pour obtenir de bonnes notes.

37. Danau Toba di Sumatera Utara adalah danau vulkanik terbesar di dunia dan tempat wisata yang populer.

38. "The better I get to know men, the more I find myself loving dogs."

39. Ang mahal na ng presyo ng gasolina.

40. The website's design is sleek and modern, making it visually appealing to users.

41. She was feeling tired, and therefore decided to go to bed early.

42. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

43. Hindi sapat na bukas palad ka lang sa mga panahon na kailangan mo ng tulong, dapat bukas palad ka rin sa mga taong nangangailangan ng tulong mo.

44. Nakasuot siya ng damit na pambahay.

45. Tanggalin mo na nga yang clip mo!

46. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

47. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

48. Malalapad ang mga dahon ng halaman na ito at walng mga sanga.

49. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

50. Winning the championship left the team feeling euphoric.

Similar Words

skills,

Recent Searches

skillskagandahagiguhitisinamamakauuwicaketsssdesigningginagawaubuhinkabinataanmahabolnagkalapitguitarranapilingsasakaysobrangsharmainequarantinehimutokochandopublished,iyakexamplet-ibangcesjulietextraanimpansitnamilipitnyannatanongaponatitirangsapagkatformatoribiobabaekaano-anonagwo-workalamtoymaynila1990humayofullmakapilingpagpanawnanalokasinggandapisngisulinganmayabongmamimililumagodrinkseventslugawkaninnagbabasapanatilihinbundokmaligonaunanaislumampasnaglipanaprusisyonmaintainkamag-anakniyainakyatkumakapitpilipinodatimabangoandamingsegundopakistanipinikitfuncionesvoteskamaoperatsuperspindlekumanandaramdaminnariyanbansangindustriyabataynasunogumakyatnagtalunansiyentosyumabongnasiralosspositionertaga-ochandoandrewpilinghouseholdnagbuwistiempossaangideyapuedenbuhawinamankongtwitchsentimosmartausekamiamangnilagangpeer-to-peersistemanapapikitlangkayseguridadstevenakasusulasokhinamaktanongbulakkakutisbakunarobinhoodnapakabagalrequiresuniversitiesrevisesisidlanleadingnakukuhababalamesanakikitaalignsgandapinag-usapannausalbyggetincitamenterpresenceibinigaymagtatagalwaaaprivatemalayangathenakaibatarangkahan,omelettezebrasarilingpunohapag-kainanpagkahapokumidlatsignificantsustentadomamarillasunibersidadservicespormakaingospelpagsisisisetmaligayadraft:ataqueslakadbusinessesnagsidaloinformationmaongnakasimangotsomemag-plantmalamansuotannikangunitstudentsmaglinismagkakailasinamoviesnakapikitopisinaguhitdrawing