Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "schedule"

1. I know we're behind schedule, but let's not cut corners on safety.

2. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

3. Puwede makita ang schedule ng biyahe ng bus?

4. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

5. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

6. The project was behind schedule, and therefore extra resources were allocated.

Random Sentences

1. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

2. Mayroon pa ho sana akong gustong itanong.

3. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

4. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

5. Hindi tayo sigurado/nakatitiyak.

6. Ang hirap maging bobo.

7. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

8. Nasa silid-tulugan ako at nagitla ako nang biglang bumukas ang bintana sa malakas na hangin.

9. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

10. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

11. Ailments can be a source of stress and emotional distress for individuals and their families.

12. Paano siya pumupunta sa klase?

13. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

14. I love you so much.

15. Bawal ang maingay sa library.

16. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

17. Ang mga kasapi ng aming angkan ay nagkakaisa sa pagtatrabaho para sa kinabukasan ng pamilya.

18. Hindi pa rin siya lumilingon.

19. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

20. Sa halip na malungkot, bagkus ay nagawa pa nitong magpasalamat sa lahat ng kanyang taga-suporta.

21. Ano ang binili mo para kay Clara?

22. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

23. Ano ang gagawin ni Trina sa Disyembre?

24. Nanalo siya ng sampung libong piso.

25. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

26. Paano umuuwi ng bahay si Katie?

27. Gracias por tu ayuda, realmente lo aprecio.

28. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

29. Ano ang paborito mong pagkain?

30. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

31. Naghihinagpis ang ina sa pagkamatay ng kanyang anak na nauwi sa isang aksidente.

32. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

33. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

34. El actor hizo un comentario controversial que está llamando la atención de los medios.

35. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

36. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

37. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

38. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

39. Gusto ko lang magpaalam nang maayos, kaya sana pwede ba kita makilala?

40. Patuloy ang kanyang paghalakhak.

41. Ang bulaklak ay mabango at nakakapagbigay ng kasiyahan sa amoy.

42. We need to address the elephant in the room and discuss the budget issues.

43. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

44. Biasanya, bayi yang baru lahir akan diperiksa secara rutin oleh dokter atau bidan untuk memastikan kesehatannya.

45. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

46. I just launched my new website, and I'm excited to see how it performs.

47. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

48. Scissors should be handled with care to avoid injuries and kept out of reach of children.

49. A series of earthquakes hit the region, causing widespread damage.

50. Effective use of emphasis can enhance the power and impact of communication.

Recent Searches

scheduleleesumalaapoykaragatansarapamoyminatamisbagamakananimpitventasafemagalangroquebinabahalagaprogramsbehaviorrangeberkeleyeveryhouseholdsmagdadapit-hapontanongmakapangyarihangmabangoinalisrepresentativespinagmakukulaybuung-buoloobpalatilidiwatamaghahandapaglulutokamanakapasadatinagpalalimmasayambalololoputolpakilutoheartbreaksapilitangpagkataposbigyankumukuhayouthengkantadangtv-showstinawagmakabilinakakamitnakikitangmakauuwiposporonapakahangakinakitaanpagbabagong-anyomaglalaronaupoumiiyaknagwelganakakabangonobservererressourcernetatawagannegro-slavesinasikasoinvestingpinagkiskismahiwagangutilizahumpaynangangalitinvestmabihisaniloilopinapalokapasyahannapanoodnakakaanimkadalaskakutiskanginastoreintensidadnapuyatkanluranmasaholkisapmataginawarantotoopundidobasketbolnanangisnaglaronaniwalakasotatlongpangakoniyonvaliosalibertykarapatangmalalakitherapeuticstog,taksimay-arihanapinitinaasfreedomsmadadalagusalinakabaonsakenituturosuwailiyakpinalayasmachinesjobkendilamangpulongkundibihasasikatmartianpanataglangkaytomorrowsinapnilitbutasanumanakongbilialamidpaksasigloriyannatagalanganidmanunulatpupuntahanchildrennakasuotfameattractivewashingtonsawatignanumaagosradioelvisdreamattentioncalciumeuphorictoreteblusanghigpitanpshmegetbatoindividualminutoespigasilangkablanvotesmulsumugodbienwordsleukemiahamaksumasambaabutanpinunittransparentinisellacoachingbrucewellipinikitkilalang-kilalaimproveabsinspiredbula