Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "pyesta"

1. Malapit na ang pyesta sa amin.

Random Sentences

1. Human activities, such as pollution and deforestation, have a significant impact on the environment.

2. Nakatapos na ako ng thesis kaya masayang-masaya ako ngayon.

3. The political campaign gained momentum after a successful rally.

4. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

5. La práctica hace al maestro.

6. Les personnes âgées peuvent souffrir de solitude et de dépression en raison de l'isolement social.

7. Ang mga manggagawa at magsasaka ay kabilang sa sektor ng anak-pawis.

8. Dali-daling umalis ang binata patungo sa palasyo.

9. Ang mga dentista ay maaaring mag-rekomenda ng mga produkto na dapat gamitin upang mapanatili ang malusog na ngipin.

10. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

11. "A dog is the only thing that can mend a crack in your broken heart."

12. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

13. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

14. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

15. Matitigas at maliliit na buto.

16. Para sa anak ni Consuelo ang T-shirt.

17. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

18. Na parang may tumulak.

19. Magbabakasyon kami sa Banawe sa tag-araw.

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. Ok. Alam mo, isa pa yung excited na magka-apo eh.

22. Maingay ang bagong taon sa Pilipinas.

23. I always feel grateful for another year of life on my birthday.

24. Sa ganang iyo, sapat ba ang paghingi niya ng tawad upang mapatawad ng lahat?

25. Ang produktong ito ay may mataas na kalidad, samakatuwid, marami ang bumibili nito.

26. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

27. Hindi dapat tayo gumamit ng marahas na wika sa mga pag-uusap.

28. Kapag walang makain ay naghuhukay ng mga gabi, tugi o anumang halamang ugat sina Karing para maipantawid-gutom.

29. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

30. Users can like, react, or share posts on Facebook to show their engagement and support.

31. Dedicated teachers inspire and empower their students to reach their full potential.

32. Es freut mich, Sie kennenzulernen. - Nice to meet you.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34.

35. Naglipana ang mga ibon sa hardin ngayong tag-araw.

36. Folk med en historie af afhængighed eller mentale sundhedsproblemer kan være mere tilbøjelige til at udvikle en gamblingafhængighed.

37. Esta comida está bien condimentada, tiene un buen nivel de picante.

38. Si Mabini ay isa sa mga pinakamatatalinong lider sa panahon ng himagsikan sa Pilipinas.

39. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

40. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

41. Umayos ka nga! Wala ka sa bahay!

42. Ang ganda naman ng bago mong cellphone.

43. The United States has been involved in many international conflicts, including World War I and World War II.

44. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

45.

46. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

47. Eine Inflation kann auch durch den Anstieg der Rohstoffpreise verursacht werden.

48. Sino ang puwede sa Lunes ng gabi?

49. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

50. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

Recent Searches

pyestalumusobniyangfreelanceraseanmagdidiskolarawanmalalimpodcasts,masayanakalilipasstoryhinihintaykakayananipinambiliinintayminutehastamatigasaudio-visuallypangakolalakekumbentoiniisipplatomabaitdulotjuiceanimoywestbosesnaggingpaidmagaling-galingmagkaibabiocombustiblesikinakagalitmakauuwiespecializadaspalipat-lipattumatanglawnagtakapagkapasoknag-poutsulatbefolkningen,pagtawapagkasabimanggagalingbwahahahahahainilistauulaminnanunurinamatayhandaankinasisindakannaglokona-fundtulisanmagsisimulainisa-isanapahintofranciscopasaherojejukadalascualquiermamahalinkasamaankarangalangayunmankalarokirbynamilipitmaya-mayatutusinganapintinanggalpakibigyancynthiaflamencokatolikokumantacrecertelephonebutterflyherramientasnagplaysisentadisyemprelasaisinumpastreetmaubosnandiyantiyandespuesdialledheartbeatfollowediniintaynasankombinationwaiterupuanpamamahinganatagalanpinagkasundomamidisposalpopularmalamangsumasakitaffiliatebumigayenergipamimilhingdefinitivogapasthmakrusparomustbilaohumblebutchhinogumaagoslumulusobsinabibaryokatutuboyeplamanbusiness,espigasinomchildrenkatandaangrinsdreamattractiveabonojanefridayipanlinismalapadsilbingsanmagdanahulicontestsuchworryneroeeeehhhhreservationcongratssumalibilerchadelectionscigarettesdiliginicehatingpinilinglorenaetodulagenerationerincreasinglyharmfuldenpamilyanaglakadroughconditiondecreasecircleseenreadingfredniceannaactionlilipadkasaysayanilalagayprofessionalpackagingpakilagaymahuhulibakepagkakalutomakahingisumigawipinikityelolasingero