Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "itinatapat"

1. At habang itinatapat nito ang balde sa gripo, muli niyang nakita na nginingisihan siya nito.

Random Sentences

1. Taga-Hiroshima ba si Robert?

2. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

3. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

4. Después de la clase, los estudiantes salen del salón y van a casa.

5. Ano ang gustong bilhin ni Juan?

6. They go to the library to borrow books.

7. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

8. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

9. No hay que buscarle cinco patas al gato.

10. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

11. Sa gitna ng tagtuyot, ang mga magsasaka ay nagiigib mula sa ilog para sa kanilang mga pananim.

12. The website's content is engaging and informative, making it a great resource for users.

13. Ako'y napatingin sa dalagang nababalot ng hiwaga

14. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

15. Fathers can be strong role models, providing guidance and support to their children.

16. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

17. Sigurado ka ba dyan, Kenji? tanong ng dad ni Athena

18. Hey! Wag mo ngang pakealaman yan! sigaw ko sa kanya.

19. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

20. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

21. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

22. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

23. Anong oras natutulog si Katie?

24. Pakibigay ng tubig sa mga trabahador sa labas, mukhang nauuhaw na sila.

25. Maraming tao sa tabing-dagat sa tag-araw.

26. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

27. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

28. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

29. Hindi ko gusto magpakita nang bastos, kaya sana pwede ba kita makilala?

30. Bakit di mo 'to sinabi sa akin?

31. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

32. Wag ka nang malumbay dahil nandito naman ako.

33. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

34. A quien madruga, Dios le ayuda.

35. Ang mga Pinoy ay likas na masipag at maabilidad sa anumang trabaho.

36. The executive branch, represented by the President of the United States, is responsible for enforcing laws

37. Under fødslen går kroppen gennem en intens og smertefuld proces.

38. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

39. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

40. Sa pangkat na iyon ay kay Ogor agad natutok ang kanyang tingin.

41. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

42. Ipapainit ko ho ito sa kusinero namin.

43. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

44. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

45. Ano ang palitan ng dolyar sa peso?

46. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

47. The exhibit features a variety of artwork, from paintings to sculptures.

48. Ngumiti lang siya saken bilang sagot.

49. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

50. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Recent Searches

itinatapatbumugaapatnapuvideosnami-misspaghahabigospelmakapalpakinabanganamericadropshipping,sigapwestosugatangproducekumanannamilipitpagbatiskillsgalaangatasutilizaniniangatsunud-sunodmatutongkonsyertokanayonibililittleagostobiyernesnapanagdaramdamgriponagreplydayparibalangtinitirhanpanindangeranpinilitwidelyentertainmenttenerumigibalmacenarbaduyipalinisbumababachesssumalamamiprovideoueseetools,pulubipeacesipaminabutigovernmenthelpfulhalagacolouraddressscheduleconsiderfencinginvolvetalegraduallyprogramming,berkeleyuloreturnedhelpkinuhabatalanhawihapasinnaglalabataposdrogabangkangkitapookhinintayinorderhalinglingkasisutilwakasnakakunot-noongsanaynagtagisannanghingidiyannakapapasongpamburanakapagngangalitnegativenagawangiintayinnabalitaanerlindaintensidadmanahimikdisfrutarnakatalungkolandlinespendingalignspitonglighthigaansinabibarcelonapagbabantakisapmataberegningerunidoslangkaysinaydelserkainanbanlagorganizeinangself-defensepinalayasbumuhoshagdanbusyutilizarlinawedsaplacedisyempreitinagocivilizationvehiclesprogrammingmustcineutilizaaniyaoperahan18thcoachingmisusedresearch:tarangkahanhardresultworryfinishedinuminbeginningideadinalacigarettestudentsnaghuhukayautomaticoffentligbasasumalinagsisigawlumitawmatakasayawpalaisipanpinabayaangagawinmakitananahimikparehongmaglalakadmagpa-ospitalnanunuksogumawatahimiknagkasakitmahiyapagtiisanwasto1960smaghahandakamalayantamadmagdilimdalawinpagngitinamulatcarsmakakasahodkinukuyomnagtakainjury