Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "two-party"

1. A bird in the hand is worth two in the bush

2. A lot of time and effort went into planning the party.

3. A wedding is a ceremony in which two people are united in marriage.

4. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

5. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

6. Congress are elected every two years in a process known as a midterm election

7. Congress is divided into two chambers: the Senate and the House of Representatives

8. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

9. Every year, I have a big party for my birthday.

10. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

11. Football is played with two teams of 11 players each, including one goalkeeper.

12. He has been hiking in the mountains for two days.

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hiram na kasuotan ang ginamit niya para sa theme party.

15. Hockey is played with two teams of six players each, with one player designated as the goaltender.

16. I have been studying English for two hours.

17. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

18. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

19. Kill two birds with one stone

20. My co-workers organized a surprise birthday party for me at the office.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. Party ni Lory? nabigla sya sakin sa sinabi ko.

25. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

26. Scissors are a cutting tool with two blades joined together at a pivot point.

27. She has been cooking dinner for two hours.

28. She spilled the beans about the surprise party and ruined the whole thing.

29. Sino ang mga pumunta sa party mo?

30. Sino-sino ang mga pumunta sa party mo?

31. Suot mo yan para sa party mamaya.

32. The basketball court is divided into two halves, with each team playing offense and defense alternately.

33. The cake was a hit at the party, and everyone asked for the recipe.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. The football field is divided into two halves, with each team playing offense and defense alternately.

36. The game is played with two teams of five players each.

37. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

38. The two most common types of coffee beans are Arabica and Robusta.

39. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

40. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

41. They have been watching a movie for two hours.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. To break the ice at a party, I like to start a game or activity that everyone can participate in.

44. Two heads are better than one.

Random Sentences

1. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

2. Sa pamamagitan ng kalayaan, malaya tayong magpahayag ng ating mga opinyon at paniniwala.

3. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

4. Hindi ninyo madadala sa hukay ang yaman ninyo.

5. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

6. Ang lugaw ay dumikit sa palayok at nasunog.

7. Kami kaya ni Maico aabot sa ganyan?

8. Nakinig ang mga estudyante sa guro.

9. Instagram is a popular social media platform that allows users to share photos and videos.

10. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

11. This could be physical products that you source and ship yourself, or digital products like e-books or courses

12. Ibinigay ko ang lahat ng aking lakas at determinasyon upang makamit ang aking mga layunin.

13. Nagbago nang lahat sa'yo oh.

14. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

15. El nacimiento de un bebé es motivo de alegría y celebración.

16. Ang saya saya niya ngayon, diba?

17. Maglalaro ako ng tennis. Ikaw?

18. Agaw eksena ang babaeng himihiyaw sa palengke.

19. Mahalaga ang pagkakaroon ng kalayaan sa edukasyon upang mapalawak ang ating kaalaman at pag-iisip.

20. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

21. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

22. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

23. Ang Ibong Adarna ay kinikilala bilang isa sa mga pinakamahalagang kwento sa panitikang Filipino.

24. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

25. This can include reading other books on the same topic, interviewing experts, or gathering data

26. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

27. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

28. Gaano ho ba kalaking lupa ang gusto ninyo?

29. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

30. TikTok has faced controversy over its data privacy policies and potential security risks.

31. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

32. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

33. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

34. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

35. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

36. Leonardo da Vinci trabajó para los Médici en Florencia.

37. Guten Tag! - Good day!

38. Isang Pinoy ang nanalo sa international singing competition.

39. No tengo palabras para expresar cuánto te agradezco.

40. Masyadong ganid sa salapi ang taong iyon.

41. Si Rizal ay kilala bilang isang makata, manunulat, pintor, doktor, at lider sa paglaban sa kolonyalismong Espanyol.

42. Malungkot ka ba na aalis na ako?

43. Da Vinci murió en Francia en el año 1519.

44. They knew it was risky to trust a stranger with their secrets.

45. Isasama ko ang aking mga kapatid sa pamanhikan.

46. Sa tulong ng isang magandang pagsasalita at pang-unawa, ang tensiyon sa pagitan namin ay napawi.

47. "Dogs are better than human beings because they know but do not tell."

48. Sa kabila ng panganib, nangahas ang grupo na pumasok sa nasusunog na gusali upang may mailigtas.

49. Wala na siguro sya, baka natulog na inantok na.

50. Matapos ang isang mahirap na araw, nagpalabas ako ng malalim na himutok para maibsan ang aking pagod.

Recent Searches

maaaritwo-partykaarawanhigh-definitionhidingomeletterepublicaniteknologikasingledthroughhinampaswalng11pmbitiwanprincepangingimibehindideyaipapahingastatusdindoessettingstructurethreebinatangayanalintuntuninandrenatingactivityandypagkababasanggolbasketubopinakamahalagangbaboynegativepaalammontrealprotestashockguroipantaloptrabahoaksiyondeliciosarosalibongpromiseipinasyanginfluencevisualmanalopagkalungkotnapakalusogbahagyangpaosgawaumibiggaanodiagnosesadverseangkopsoftwaredinalawmag-plantlimoslumapadhoweverharmfulsponsorships,nanghihinapagkaimpaktomaglalakadnaglalakadnanghihinamadlumingoninakalangnahuhumalingnapakagagandananlilisiknaupotvslangostamagkakaroontumigilfactoresmamahalinnaglokohanpartsmahinognakakatabatravelpahahanapnaghuhumindiglondonmaintindihankaninumanlumakinaglokoiglapsaranggolapagbabantabinuksannalugodmahabangemocionestienenpatakbongpatawaringinawangalaknatalohawlatanyagmatandangpisarakasangkapanbayaningmarinigmahigpitnagniningningnuevonakasakaypaladmaatimfederalidiomalubosannikasinakainisbalinganentertainmentforskelcompositoresnatulogkayaproducts:bandamasarapiyonhomemukhaopportunitiesimageslimitedkabuhayansignhmmmmaskipakealamsumigawgagdollyknownfreebinigaymansanasattractivebelldontpulawalisresearch:cardhadhithalamanputaheperaforceslitomagtanghaliangayunmanhighdollarnaiinggitincreasinglyiosbulaabalaneedmundo2001nasundoactionoffentligbeginningpronounmahabaandroidformatbituinheftycorner