Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "two-party"

1. A bird in the hand is worth two in the bush

2. A lot of time and effort went into planning the party.

3. A wedding is a ceremony in which two people are united in marriage.

4. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

5. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

6. Congress are elected every two years in a process known as a midterm election

7. Congress is divided into two chambers: the Senate and the House of Representatives

8. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

9. Every year, I have a big party for my birthday.

10. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

11. Football is played with two teams of 11 players each, including one goalkeeper.

12. He has been hiking in the mountains for two days.

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hiram na kasuotan ang ginamit niya para sa theme party.

15. Hockey is played with two teams of six players each, with one player designated as the goaltender.

16. I have been studying English for two hours.

17. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

18. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

19. Kill two birds with one stone

20. My co-workers organized a surprise birthday party for me at the office.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. Party ni Lory? nabigla sya sakin sa sinabi ko.

25. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

26. Scissors are a cutting tool with two blades joined together at a pivot point.

27. She has been cooking dinner for two hours.

28. She spilled the beans about the surprise party and ruined the whole thing.

29. Sino ang mga pumunta sa party mo?

30. Sino-sino ang mga pumunta sa party mo?

31. Suot mo yan para sa party mamaya.

32. The basketball court is divided into two halves, with each team playing offense and defense alternately.

33. The cake was a hit at the party, and everyone asked for the recipe.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. The football field is divided into two halves, with each team playing offense and defense alternately.

36. The game is played with two teams of five players each.

37. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

38. The two most common types of coffee beans are Arabica and Robusta.

39. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

40. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

41. They have been watching a movie for two hours.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. To break the ice at a party, I like to start a game or activity that everyone can participate in.

44. Two heads are better than one.

Random Sentences

1. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

2. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

3. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

4. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

5. Mahalaga ang regular na pagsisipilyo at paggamit ng dental floss upang maiwasan ang mga sakit sa bibig.

6. Magkaiba ang disenyo ng mga blusa namin.

7. Kumaripas si Mario nang mahulog ang kanyang sumbrero sa kalsada.

8. Ang mga estudyante ay pinagsisikapan na makapasa sa kanilang mga pagsusulit upang maabot ang kanilang mga pangarap.

9. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

10. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

11. Masakit ang ulo ng pasyente.

12. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

13. Ang paglapastangan sa mga pampublikong lingkod ay dapat maparusahan nang naaayon sa batas.

14. Kapag ako'y nasa eroplano, natatanaw ko ang iba't ibang mga pook sa ibaba.

15. Einstein was also an accomplished musician and played the violin throughout his life.

16. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

17. Dumating ang bus mula sa probinsya sa hatinggabi.

18. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

19. I am not listening to music right now.

20. Ang maniwala sa sabi-sabi, walang bait sa sarili.

21. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

22. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

23. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

24. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

25. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

26. They admire the way their boss manages the company with fairness and efficiency.

27. Money is a medium of exchange used to buy and sell goods and services.

28. Eating healthy is an important way to take care of your body and improve your quality of life.

29. La creatividad es fundamental para el desarrollo de ideas innovadoras.

30. Gusto kong mag-order ng pagkain.

31. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkasira ng mga personal na relasyon.

32. Masarap maligo sa swimming pool.

33. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

34. Nakatingin siya sa labas ng bintana, waring may hinihintay.

35. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

36. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

37. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

38. Las compras en línea son una forma popular de adquirir bienes y servicios.

39. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

40. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

41. Dalawampu't walong taong gulang si Paula.

42. Hindi naman yan iniisip eh! Pinapakiramdaman!

43. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

44. Cryptocurrency can be used for both legal and illegal transactions.

45. At blive kvinde kan også være en tid med forvirring og usikkerhed.

46. Some fruits, such as strawberries and pineapples, are naturally sweet.

47. Maraming lumabas na balita ukol kay Pangulong Manuel L. Quezon.

48. The company acquired assets worth millions of dollars last year.

49. Håbet om en bedre fremtid kan give os motivation til at arbejde hårdt.

50. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Recent Searches

two-partyguerrerodundali-dalimaipapautangmilakitazoomnagtagisansinaliksikmandukottibokrepublicande-latamonitorfollowing,hindebevarekukuhaagadmatatagpinagsasabiakoadicionalesilingnohbinigyankapwadatimasayangkagalakanorasnagmumukhaguitarranapabuntong-hiningafourpookmanilbihanriskmethodsplasmapunsolightsipagpointpapalapitleukemiahuhknowledgematigasumiiyakmuntingrecibirbataycruztiktok,kaedadnobletransmitspahiramtsaatontogetherdinirightiikotmalikotpamilyapakpakmatagpuannalulungkotkalagayanmalayahawlatiningnandalakwebanglalimexpensesmunabuhaymagbibiladnasasaktanlakascloseamazonnagtatampopaaiyanautomationmagkanopinaghihiwasusiilalagaysilayipongkonsiyertohamaktsakatinakasangoshwatchlimitlumulusobmediakampanatinikdecreasednababakasmagulayawkantaoveralltulongmagdilimgamitinprincebarangaylikastabasbarkonasunogdalhandiamondouttutorialssensibletagumpaymangingibigpiecespag-uwinadadamaynandoonjennypaglulutosouthangkopdrayberyamanpagtatapostuluyannagpakitavariouscriticscitizenkumakalansingbumahakitangpersonasginawafamesampungnagdiretsoeffecttinginbulalasbasketballellatheredadalawinmaginghaponkasalanankinalilibingandiaperhumalakhakhugis-uloospitalanongpinagkasundoflerehongnakakatandaroughtungawnalalamannapatawaddustpansinisiraculpritunibersidadsinasakyanusingjosesciencemagdaraosgumalingmahiwagangtechnology18thfacemaskpinakamahabalalamunanmikaelaatechangedmeansuchnagniningningopportunityeach