Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "two-party"

1. A bird in the hand is worth two in the bush

2. A lot of time and effort went into planning the party.

3. A wedding is a ceremony in which two people are united in marriage.

4. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

5. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

6. Congress are elected every two years in a process known as a midterm election

7. Congress is divided into two chambers: the Senate and the House of Representatives

8. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

9. Every year, I have a big party for my birthday.

10. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

11. Football is played with two teams of 11 players each, including one goalkeeper.

12. He has been hiking in the mountains for two days.

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hiram na kasuotan ang ginamit niya para sa theme party.

15. Hockey is played with two teams of six players each, with one player designated as the goaltender.

16. I have been studying English for two hours.

17. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

18. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

19. Kill two birds with one stone

20. My co-workers organized a surprise birthday party for me at the office.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. Party ni Lory? nabigla sya sakin sa sinabi ko.

25. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

26. Scissors are a cutting tool with two blades joined together at a pivot point.

27. She has been cooking dinner for two hours.

28. She spilled the beans about the surprise party and ruined the whole thing.

29. Sino ang mga pumunta sa party mo?

30. Sino-sino ang mga pumunta sa party mo?

31. Suot mo yan para sa party mamaya.

32. The basketball court is divided into two halves, with each team playing offense and defense alternately.

33. The cake was a hit at the party, and everyone asked for the recipe.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. The football field is divided into two halves, with each team playing offense and defense alternately.

36. The game is played with two teams of five players each.

37. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

38. The two most common types of coffee beans are Arabica and Robusta.

39. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

40. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

41. They have been watching a movie for two hours.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. To break the ice at a party, I like to start a game or activity that everyone can participate in.

44. Two heads are better than one.

Random Sentences

1. Ngunit hindi niya alam na nakasunod ang mga kababayang niyang walang ibang inisip kundi makakuha ng pagkain.

2. Bakasyon ko na sa susunod na buwan.

3. En invierno, muchas personas disfrutan de deportes como el esquí y el snowboard.

4. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

5. Tuluy-tuloy niyang tinungo ang hagdan.

6. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

7. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

8. Aling bisikleta ang gusto mo?

9. Las redes sociales permiten a las personas conectarse y compartir información con amigos y familiares.

10. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

11. Sino ba talaga ang tatay mo?

12. Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

13.

14. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

15. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

16. Kapitbahay ni Armael si Juang malilimutin.

17. Makinig ka na lang.

18. Ang pag-ikot ng mga isyu at pagkukubli ng mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

19. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

20. Ang paglapastangan sa mga karapatan ng mga katutubo ay nagpapakita ng di-pagkakapantay-pantay sa lipunan.

21. Anong pagkain ang inorder mo?

22. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

23. Bitbit ng isang kamay ang isang pangnang sisidlan ng kanyang pamimilhing uulamin.

24. Inalok niya ako ng mga kakanin na hinugot niya sa kanyang tindahan.

25. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

26. Ngumiti muna siya sa akin saka sumagot.

27. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

28. Maganda ang mga alaala ko dito sa Pilipinas.

29. Ano naman ang gagawin mo sa inyong hardin? wika ng binata

30. Nagkita kami kahapon ng tanghali.

31. Limitations can be perceived or real, and they can vary from person to person.

32. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

33. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

34. Nous allons nous marier à l'église.

35. Les archéologues utilisent la science pour comprendre les cultures du passé.

36. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

37. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

38. Más vale tarde que nunca.

39. Kanina pa siya ganyan kuya.. parang ang lalim ng iniisip.

40. The fashion designer showcased a series of collections, each with its own unique theme and style.

41. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

42. Ang mabuting anak, nagpapalakas ng magulang.

43. Saya cinta kamu. - I love you.

44. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

45. Anong klaseng kuwarto ang gusto niya?

46. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

47. A continuación se detallan los pasos para cultivar maíz en casa o en un pequeño huerto

48. A palabras necias, oídos sordos. - Don't listen to foolish words.

49. Dala ito marahil ng sumpa sa iyo ni Matesa.

50. Transkønnede børn og unge skal have adgang til støtte og ressourcer til at udforske deres kønsidentitet i en tryg og støttende miljø.

Recent Searches

two-partystreamingnewspapersnobelaibinigayhamakperoclientesnilayuanburolpuedensubjectumutangreynaricasaannanaloamazonnakakagalakatutubogusting-gustoniyanshapingbighanibagamatkasiyahankaagawkayisipandinanassino-sinogamitnagkapilatnadamapabalangmind:masayangrailmatatagalagafluidityranaynakatulogtigilnaggalanasirarateumimiknangdyosasistemalumapadreorganizingmalezapreskomamayainaapisallycelebranagbabasanaaalalalenguajelibrarynagproporcionarreservestransportpumilikumakapaltsinelastaongmarunongkaragatanhandaandresnandunipaghandagumandasumandalnandoontig-bebenteandyanmasukolandreatungomaghahandaeksportererbasuraperabilanginganangpagdamibawalanokabinataanpagkalungkotpusangjunepakakasalansinamakipag-barkadanasannagmungkahibarothereforepaapinalalayastrippaki-chargeriskjustforcesumingitraisemindanaoprosperdespitelibretatayonevernahulogvisshouldespadaendfremtidigegospelmaisiptipostsssmaglinistowardskrushapdihalalanpabigatlalakepalibhasapauliiwandenabanganditomawawalanatinmerlindalandmabangosapotexperiencespasasalamatpinagpapaalalahanankaramihanpinagsulatmagagamitpatutunguhanmatatandarimasniyamaingatoverviewmississippiwifiawitawang-awaaudio-visuallybinilhanestudioinatupagilagaypaldakamotesakyanlabahinbugtongkeepingparehasmagsusunuranpagbubuhatanhaponsikonag-aagawannagbigayimpenlangitwasakakongbigongmag-isaantonioiloilohalagasorpresaxviinami-misstirahanmirakerbbalotnilulon