Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "two-party"

1. A bird in the hand is worth two in the bush

2. A lot of time and effort went into planning the party.

3. A wedding is a ceremony in which two people are united in marriage.

4. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

5. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

6. Congress are elected every two years in a process known as a midterm election

7. Congress is divided into two chambers: the Senate and the House of Representatives

8. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

9. Every year, I have a big party for my birthday.

10. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

11. Football is played with two teams of 11 players each, including one goalkeeper.

12. He has been hiking in the mountains for two days.

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hiram na kasuotan ang ginamit niya para sa theme party.

15. Hockey is played with two teams of six players each, with one player designated as the goaltender.

16. I have been studying English for two hours.

17. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

18. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

19. Kill two birds with one stone

20. My co-workers organized a surprise birthday party for me at the office.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. Party ni Lory? nabigla sya sakin sa sinabi ko.

25. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

26. Scissors are a cutting tool with two blades joined together at a pivot point.

27. She has been cooking dinner for two hours.

28. She spilled the beans about the surprise party and ruined the whole thing.

29. Sino ang mga pumunta sa party mo?

30. Sino-sino ang mga pumunta sa party mo?

31. Suot mo yan para sa party mamaya.

32. The basketball court is divided into two halves, with each team playing offense and defense alternately.

33. The cake was a hit at the party, and everyone asked for the recipe.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. The football field is divided into two halves, with each team playing offense and defense alternately.

36. The game is played with two teams of five players each.

37. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

38. The two most common types of coffee beans are Arabica and Robusta.

39. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

40. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

41. They have been watching a movie for two hours.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. To break the ice at a party, I like to start a game or activity that everyone can participate in.

44. Two heads are better than one.

Random Sentences

1. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

2. Fathers can also play an important role in teaching life skills and values to their children.

3. Amazon started as an online bookstore, but it has since expanded into other areas.

4. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

5. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

6. Ang presyo ng gulay sa palengke ay mababa ngayong linggo.

7. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

8. Noong una ho akong magbakasyon dito.

9. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

10. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

11. Ang pagpapa-tanggal ng ngipin ay ginagawa kapag hindi na maaring malunasan ang sira nito.

12. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

13. Kanino humingi ng tulong ang mga tao?

14. Lumayo siya sa amin, waring nais niyang mapag-isa.

15. Isang Saglit lang po.

16. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

17. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

18. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

19. They have been dancing for hours.

20. She has started a new job.

21. Last full show tayo. Ano bang pinakamalapit na mall?

22. Libre ba si Carol sa Martes ng gabi?

23. Muchas personas disfrutan tocando instrumentos musicales como hobby.

24. Inakalang tama ang sagot niya sa pagsusulit, ngunit mali pala.

25. Gaano ka kadalas kumain ng baboy?

26. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

27. Ano ba pinagsasabi mo! Baliw ka ba! Umalis ka nga!

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. Gawin mo ang nararapat.

30. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

31. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

32. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

33. Ano ho ba ang masarap na putahe ninyo?

34. It's frustrating when people beat around the bush because it wastes time and creates confusion.

35. This can be a great way to leverage your skills and turn your passion into a full-time income

36. Pada umumnya, keluarga dan kerabat dekat akan berkumpul untuk merayakan kelahiran bayi.

37. Håbet om en bedre fremtid kan give os motivation til at arbejde hårdt.

38. Di Indonesia, pemerintah mendorong pembinaan nilai-nilai keagamaan yang inklusif dan menggalakkan semangat gotong royong berbasis agama.

39. Edukasyon ay paghusayan upang malayo sa kahirapan.

40. Inakalang imposible ang kanyang pangarap, pero naabot niya ito.

41. Sinabihan siya ng magulang na huwag maging maramot sa kanyang mga kapatid.

42. Ikinakagalit ko ang mga sakim na minahan.

43. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

44. Magkano ang polo na binili ni Andy?

45. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

46. Pagkaraa'y nakapikit at buka ang labing nag-angat siya ng mukha.

47. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

48. The professor delivered a series of lectures on the subject of neuroscience.

49. Kapag pumunta ako, may makakawawa.

50. Hinawakan ko yung tiyan ko, Konting tiis na lang..

Recent Searches

opopanindangexhausteddinanastwo-partymurangbalangmoodsumakitchoicetakesnaghinalaaywannatanggappinaladlaborperagawinitimfansipasokpasswordpetsaknowsdesdeabstainingexperienceslabingdadplanimagingordertruepracticadofaultlastingkarnabalmarasiganwastemalakinghalosinternaadaptabilitytablemarkedbaberawechavenariningpaglulutoyoutubekatagajobstatlokulay-lumotpookpumuntanakapaligidvelfungerendeitaksalitangtuktokipinansasahogtanggalinbienfurtherumanobanlagaralsugatangberkeleynakasandignakapamintanapoliticalpagkakapagsalitapinakamahalagangnakakitadalagangmalulungkotninamumuntingnabighanileksiyonarbejdsstyrkelalakadhalu-halonagmistulangcrucialincreasemagbibiladthanknawalainakalangmasayahinpinagmamasdanpalabuy-laboypagtiisanopgaver,nagpepekeinvestingmakikipaglaronag-iinommakikiraanpagkakamalimusicianagricultoresnaninirahanngingisi-ngisinghalamanmaanghangkontratakondisyoncorporationnagpalutoyakapinpamilyamaulinigannapapansinkaninumanscalelumungkotpakakasalantelebisyonpagbebentaiiwasanpandidiripasaheroinvesting:nakakaanimcountrynapahintonakakasulatsinumannapakamothinihintaypakikipaglabanmakakakulayfranciscohalamangnagpapaypaykanya-kanyangvictoriatamarawpakiramdamnanamanmagbabalamagkabilangnaguusaptienenlumindolnationalnatakotfollowedpneumoniacommercialasukalnatuyonaantigkilaymakalingpakibigyannatuloydyosahumiganapasukobibigyanduwendepalitanunoshihigitpauwinahulaanisinumpasadyangricokayotondocalidadentertainmentawardinitdesarrollarhoteldomingotugontulalamaayostigasbilanggogreatlyabalangmabaitlistahaniniibiglalakekumbentonagisingmayamangmaistorbo