Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "two-party"

1. A bird in the hand is worth two in the bush

2. A lot of time and effort went into planning the party.

3. A wedding is a ceremony in which two people are united in marriage.

4. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

5. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

6. Congress are elected every two years in a process known as a midterm election

7. Congress is divided into two chambers: the Senate and the House of Representatives

8. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

9. Every year, I have a big party for my birthday.

10. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

11. Football is played with two teams of 11 players each, including one goalkeeper.

12. He has been hiking in the mountains for two days.

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hiram na kasuotan ang ginamit niya para sa theme party.

15. Hockey is played with two teams of six players each, with one player designated as the goaltender.

16. I have been studying English for two hours.

17. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

18. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

19. Kill two birds with one stone

20. My co-workers organized a surprise birthday party for me at the office.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. Party ni Lory? nabigla sya sakin sa sinabi ko.

25. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

26. Scissors are a cutting tool with two blades joined together at a pivot point.

27. She has been cooking dinner for two hours.

28. She spilled the beans about the surprise party and ruined the whole thing.

29. Sino ang mga pumunta sa party mo?

30. Sino-sino ang mga pumunta sa party mo?

31. Suot mo yan para sa party mamaya.

32. The basketball court is divided into two halves, with each team playing offense and defense alternately.

33. The cake was a hit at the party, and everyone asked for the recipe.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. The football field is divided into two halves, with each team playing offense and defense alternately.

36. The game is played with two teams of five players each.

37. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

38. The two most common types of coffee beans are Arabica and Robusta.

39. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

40. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

41. They have been watching a movie for two hours.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. To break the ice at a party, I like to start a game or activity that everyone can participate in.

44. Two heads are better than one.

Random Sentences

1. Mahalagang maglaan ng sapat na oras sa pag-aaral upang magtagumpay sa buhay, samakatuwid.

2. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

3. Hindi ako masyadong mahilig sa pagpupuyat sa hatinggabi dahil masama ito sa kalusugan.

4. It was supposed to be a surprise promotion, but the boss let the cat out of the bag during a meeting.

5. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

6. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

7. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

8. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

9. Paborito ko kasi ang mga iyon.

10. We admire the creativity of innovative thinkers and inventors.

11. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

12. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

13. Ate, gusto ko sanang mag-isa.. ok lang ba?

14. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

15. Claro que entiendo tu punto de vista.

16. Este plato tiene un toque picante que lo hace especial.

17. A lot of birds were chirping in the trees, signaling the start of spring.

18. She loved to travel, and therefore spent most of her savings on trips.

19. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

20. Kailan ka libre para sa pulong?

21. Claro, puedes contar conmigo para lo que necesites.

22. Sop buntut adalah sup yang terbuat dari ekor sapi dengan rempah-rempah dan sayuran yang kaya rasa.

23. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

24. Nauntog si Jerome sa kanilang pintuan.

25. Dalhan ninyo ng prutas si lola.

26. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

27. Ang dating kawawang usa a naging isang napakagandang diwata subalit hindi na rin natago ang mga sugat nito.

28. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

29. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. Tanging ina lang at kapatid niya ang kanyang kasama

32. Las escuelas también ofrecen programas de educación para adultos.

33. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

34. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

35. Pumunta ako sa Iloilo noong tag-araw.

36. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

37.

38. Bukas na daw kami kakain sa labas.

39. The United States is a federal republic, meaning that power is divided between the national government and the individual states

40. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

41. Pedeng ako na lang magsubo sa sarili ko?

42. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

43. Nang matanggap ko ang pagbati at papuri sa aking gawa, ang aking kaba at pag-aalinlangan ay napawi.

44. Anong kulay ang gusto ni Elena?

45. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

46. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

47. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

48. Ang carbon dioxide ay inilalabas ng mga tao.

49. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

50. Tila nagtatampo siya dahil hindi mo siya kinausap kanina.

Recent Searches

two-partytongtalebroadpalikuranapomatayogtuladmaisjingjingmarahillupapaghuhugaskemi,malilumakingtherapythroughpaninginmagsi-skiingkinauupuankayapublishing,kakaantaysalitawouldscientistafterpakikipaglabanjunenakabalikmamarilsalamangkerodasalverydavaotanawmakisigkahulugankangkongsupilinheycrazywonderssuedenapapasayanagriyanbahay-bahayankarangalanditokagyatesténag-away-awayhinagpisopokaaya-ayangpoliticsmakatulongnakatitiyakkartongsasapakinmaranasanngunitganangourpositibotamadelepantenatuyobumisitanakapilarevolutioneretmasayangmini-helicopternangangalitginilingcolouripanlinisforeverisuboelectionkinaiinisanpakealamagam-agamattorneylongsipacornerfacebookextranakakunot-noonginsidentesaandagat-dagatankalayaanfourjackanitumulakskillsnag-iisagassweetaraw-arawroofstockbiologimapapansinkalannakakaakitvelstandtitiraperaseryosobeginningnag-aalalangmakapaniwalailongkamipinagpapaalalahananpilipinasbakitvideonagtutulaknakangitimovingeyedogsanytatayokalayuanakalaingnewsmamimisstrasciendebuhokmag-anakbumababaibabawbinibiyayaanlarawanimportantesaggressionduriannowsagotpopcornumuwiikinagagalakconmind:zamboangamamataanpakiramdampusangpagsasalitatupelobabaebolatekstbreakschooltiniklingsinohayoppinabulaanmanykulognag-aasikasokagubatanbumilikainnatakotpag-aagwadorsinumanbinilingdalaganaistayosunud-sunodtrajebagsakpakinabangancarepagbisitaleytestreaming1940niyakapmarsonagdabogtiningnanbilibidkaratulangnakatiradecisionscolorallewasteunti-unti