Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "two-party"

1. A bird in the hand is worth two in the bush

2. A lot of time and effort went into planning the party.

3. A wedding is a ceremony in which two people are united in marriage.

4. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

5. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

6. Congress are elected every two years in a process known as a midterm election

7. Congress is divided into two chambers: the Senate and the House of Representatives

8. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

9. Every year, I have a big party for my birthday.

10. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

11. Football is played with two teams of 11 players each, including one goalkeeper.

12. He has been hiking in the mountains for two days.

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hiram na kasuotan ang ginamit niya para sa theme party.

15. Hockey is played with two teams of six players each, with one player designated as the goaltender.

16. I have been studying English for two hours.

17. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

18. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

19. Kill two birds with one stone

20. My co-workers organized a surprise birthday party for me at the office.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. Party ni Lory? nabigla sya sakin sa sinabi ko.

25. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

26. Scissors are a cutting tool with two blades joined together at a pivot point.

27. She has been cooking dinner for two hours.

28. She spilled the beans about the surprise party and ruined the whole thing.

29. Sino ang mga pumunta sa party mo?

30. Sino-sino ang mga pumunta sa party mo?

31. Suot mo yan para sa party mamaya.

32. The basketball court is divided into two halves, with each team playing offense and defense alternately.

33. The cake was a hit at the party, and everyone asked for the recipe.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. The football field is divided into two halves, with each team playing offense and defense alternately.

36. The game is played with two teams of five players each.

37. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

38. The two most common types of coffee beans are Arabica and Robusta.

39. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

40. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

41. They have been watching a movie for two hours.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. To break the ice at a party, I like to start a game or activity that everyone can participate in.

44. Two heads are better than one.

Random Sentences

1. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

2. Ang pagpapahinga ng isip at katawan sa pamamagitan ng meditasyon ay nagdudulot ng isang matiwasay na kalagayan.

3. Ito na ang kauna-unahang saging.

4. "Tuloy po kayo," ani ng matanda sa bisita niyang dumating.

5. Ano ang kulay ng paalis nang bus?

6. A los 13 años, Miguel Ángel comenzó su aprendizaje en el taller de Domenico Ghirlandaio.

7. Sa pakikipag-ugnayan sa ibang tao, huwag magpabaya sa pakikinig at pang-unawa sa kanilang mga saloobin.

8. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

9. Ang pagtulog ng tamang posisyon ay maaaring makatulong sa pag-iwas sa mga sakit sa likod at leeg.

10. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

11. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

12. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

13. Vous parlez français très bien.

14. Tumingin siya saken at sa malungkot na mukah ay umiling.

15. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

16. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

17. Anong klaseng karne ang ginamit mo?

18. Ang kanilang tirahan ay nasa mababa na lugar kaya laging binabaha.

19. Nakasandig ang ulo sa tagpiang dingding.

20. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

21. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

22. Sa dakong huli ng aking buhay, sana ay masabi ko na nagawa ko ang lahat ng gusto kong gawin.

23. Ang ganda ng sapatos ni Junjun.

24. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

25. Disculpe señor, señora, señorita

26. The authorities were determined to find the culprit responsible for the environmental damage.

27. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

28. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

29. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

30. Mahusay talaga gumawa ng pelikula ang mga korean.

31. Pakiluto mo nga ng pancit ang mga bata.

32. Dette er med til at sikre, at Danmark har en bæredygtig økonomi, der er i stand til at bevare ressourcerne til fremtidige generationer

33. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

34. Upang makita niya ang babaing gaganda pa sa sumpa sa kanya, nagdala siya ng ilaw tuwing gabi.

35. Si Jose ay na-suway sa simpleng paalala na huwag mangulangot sa harap ng ibang tao.

36. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

37. Alin ang telepono ng kaibigan mo?

38. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

39. The chef created a series of dishes, showcasing different flavors and textures.

40. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

41. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

42. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

43. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

46. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

47. May anim na silya ang hapag-kainan namin.

48. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

49. Anong kailangan mo? pabalang kong tanong.

50. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

Recent Searches

two-partyiconickagabicruznakasimangotreservesgisingmedievalsnobpierreboundpeacekaingabingmeaningbabaejerrybugtongstarspecialpagbahingveryprocesotonsinipanggupitcomepangulotandacondoforcesipinabalikknowsmajornamingpapuntaideaconsiderarobstaclesreportnutrientesataquesipipilitilanconectanestasyonipihitcontinuedhapasincontenthulingincreasedimagingrelievedmonetizingcornergrabeexampleevolvedefficientexistincreasethreescalewhichaffectmalapitincreasinglyqualitynag-iisangmaglalarogumagalaw-galawnag-poutbaldebarotechnologicalkumalmainantoktravelersananatulogmulai-googlepagdatingkapangyarihantanimgayundinkalaunanopgaverhinugotkinakitaanmahabangnakadapaattractivekawili-wilikakuwentuhannagtatakbonag-umpisabutiniinommerlindamedya-agwaanibersaryogratificante,magpa-checkupnakakapasokmagpapabunotnagtutulakmagtanghalianvirksomhedertinaasanpagngitinakuhakumidlatmedisinapahahanappagkalitokumikilosnaglababalangnag-uumirinagsusulatnagpatuloynagwelgaenergy-coalglobalisasyonnamumulotnicehayaanginaaminnagtalagapagkaraakabutihannovellescultivationduonmakatiyakprincipalesnasisiyahanmagsunogkapintasangsay,naglahoalapaapklasrumjosietig-bebeinteika-12honestomagsungitkakilalapaaralanhinabapalantandaanguerrerolabistinanggalcombatirlas,karapatangmasayang-masayamaligayamaiingaypalagifreedomsmaskinerniyogmaynilahistoriauniversitiesyumuyukoeleksyonmagdaansongsibabawisubolittlemadamingginawaranmachinesjagiyainintayganunmagsaingbutoatensyonrosellesumisidanghelkasalananpublicitylagunanogensindecelularescoalgranadamalayangareassemillasdispositivoswaiter