Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "two-party"

1. A bird in the hand is worth two in the bush

2. A lot of time and effort went into planning the party.

3. A wedding is a ceremony in which two people are united in marriage.

4. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

5. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

6. Congress are elected every two years in a process known as a midterm election

7. Congress is divided into two chambers: the Senate and the House of Representatives

8. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

9. Every year, I have a big party for my birthday.

10. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

11. Football is played with two teams of 11 players each, including one goalkeeper.

12. He has been hiking in the mountains for two days.

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hiram na kasuotan ang ginamit niya para sa theme party.

15. Hockey is played with two teams of six players each, with one player designated as the goaltender.

16. I have been studying English for two hours.

17. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

18. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

19. Kill two birds with one stone

20. My co-workers organized a surprise birthday party for me at the office.

21. My coworkers threw me a surprise party and sang "happy birthday" to me.

22. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. Party ni Lory? nabigla sya sakin sa sinabi ko.

25. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

26. Scissors are a cutting tool with two blades joined together at a pivot point.

27. She has been cooking dinner for two hours.

28. She spilled the beans about the surprise party and ruined the whole thing.

29. Sino ang mga pumunta sa party mo?

30. Sino-sino ang mga pumunta sa party mo?

31. Suot mo yan para sa party mamaya.

32. The basketball court is divided into two halves, with each team playing offense and defense alternately.

33. The cake was a hit at the party, and everyone asked for the recipe.

34. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

35. The football field is divided into two halves, with each team playing offense and defense alternately.

36. The game is played with two teams of five players each.

37. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

38. The two most common types of coffee beans are Arabica and Robusta.

39. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

40. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

41. They have been watching a movie for two hours.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. To break the ice at a party, I like to start a game or activity that everyone can participate in.

44. Two heads are better than one.

Random Sentences

1.

2. Kahit mahirap ang buhay noon, nagsumikap si Carlos Yulo upang maabot ang kanyang mga pangarap.

3. Pumasok po sa restawran ang tatlong lalaki.

4. Gaano kabilis darating ang pakete ko?

5. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

6. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

7. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

8. Mangungudngod siya, mahahalik sa lupa.

9. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

10. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

11. Hindi ninyo madadala sa hukay ang yaman ninyo.

12. If you quit your job in anger, you might burn bridges with your employer and coworkers.

13. They go to the movie theater on weekends.

14. The singer on stage was a beautiful lady with an incredible voice.

15. Pupunta ako sa opisina ko sa Makati.

16. Hindi naman yan iniisip eh! Pinapakiramdaman!

17. Kaya't pinabayaan na lang niya ang kanyang anak.

18. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

19. Walang bagay na di makita at agad tinatanong ang kanyang ina.

20. Pumitas siya ng isang bunga at binuksan iyon.

21. Oo. Gusto ko na lang sana talaga makauwi. sagot ko.

22. Pupunta si Pedro sa unibersidad.

23. There were a lot of people at the concert last night.

24. Nagbigay ng malaking tulong sa akin ang aking guro sa paghahanda sa aking thesis.

25. Siya ang may pinakamataas na grado sa klase, samakatuwid, siya ang napiling valedictorian.

26. Ang pagdidilim ng aking paningin ay nagpahiwatig ng pagdating ng masamang panahon.

27. Padabog akong umupo habang dumadating na yung order nya.

28. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

29. Gumawa ng pangit na drowing ang kaibigan ko.

30.

31. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. He has been gardening for hours.

34. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

35. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

36. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

37. Natuto siyang lumaban sa kaniyang mga magulang.

38. May ngiti ng kasiyahang naglalaro sa maninipis na labi ni Aling Marta nang ipihit niya ang kanyang mga paa patungong pamilihan.

39. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

40. The invention of the telephone and the internet has revolutionized the way people communicate with each other

41. Kailan nagtapos ng kolehiyo si Peter?

42. Saan kami kumakain ng mami at siopao?

43. Mahal ang mga bilihin sa Japan.

44. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

45. I don't have time for you to beat around the bush. Just give me the facts.

46. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

47. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

48. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

49. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

50. Kahit na magkaiba kami ng wika, naging magkaibigan pa rin kami dahil sa aming kaulayaw sa isa't isa.

Recent Searches

two-partypakealambumotolayascivilizationnababakasusapopulationalambabaepresence,siyudaddiagnosesritwalmamipinggaparkingnakatuklawnakituloghunyotumambadsouthallowingrevolutioneretmassachusettsmarahanpaglalabadacourtnakatagomarumipinamalagiculturestinutopnanlalamigfestivalesleksiyonkalaunantumatanglawtanggalinpinasalamatanbisitamalezaskymarketplacesnapakatalinobalik-tanawpinakamaartengnakakatawamakapangyarihannagtatakbopinagsikapankinatatalungkuangpunong-kahoybinabaanpinansinsundhedspleje,nakapagsalitamagkaparehopagkakalutonakakapasoknabubuhaypaumanhinyongniyogdiyabetisdahan-dahanpagdukwangmakatarungangkinakabahansaritaturismomaaringpandidirimahinogtemparaturaninanaisnapapansinnaglahoareasprovideestasyonaga-agaedukasyonnoongsiyentoslumusobdiseasegelaijosiebairdpwedengna-curiousnaabotiyaktugonofrecendisenyosayastockskaliwangpublishing,bumigaymauliniganmagtipiddailyjenarightstuffedplatformskalabanrespektivegagamitkasalukuyankastilasaktanundeniablesinabigalitrequierenmag-aaralpinalambotbarcelonaailmentssobrangtelevisionadvertisingipinambilisigurotraditionaldanzamangingisdakalakingfauxadoptedcarmen300producirexperiencesgreenmenoskantocharminginisminutemalabophysicalfascinatingsocietyatafinishedgamepangalankapagcongressnapupuntanagkakasayahannakapagreklamopanunuksongnaglalatangnakakatulongvampiresmainitpesospagpapatubopare-parehopinaghihiwakahirapanibinentaskyldesnanaisinnagtatanongpaidnakalagaypagsumamomagpaliwanagnaguguluhangcultivarmakipag-barkadapamahalaannapaiyakkuwartoclassespinabayaannakatapatkabosespanghihiyangmahiwagangtatawaganmiraskills,pinapasayapinakamahabalabing-siyamgulatskypekinauupuanunti-untinagpabayadnapakagagandamahahalik