Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "end"

1. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

2. Eksporterer Danmark mere end det importerer?

3. Fra biler til fly til tog, teknologi har gjort det muligt for os at bevæge os hurtigere og mere effektivt end nogensinde før

4. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

5. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

6. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

7. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

8. The construction of the building required a hefty investment, but it was worth it in the end.

9. The laptop's hefty price tag reflected its powerful specifications and high-end features.

10. The movie was absolutely captivating from beginning to end.

11. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

Random Sentences

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Si Chavit ay may alagang tigre.

3. She draws pictures in her notebook.

4. Sa muling pagtataas ng tungkod ng matanda, lalong dumagundong ang mga kulog at tumalim ang mga kidlat.

5. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

6. Isa lang ang bintana sa banyo namin.

7. Don't worry about making it perfect at this stage - just get your ideas down on paper

8. Saan niya pinagawa ang postcard?

9. Gaano kalaki ang bahay ni Erap?

10. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

11. Si Emilio Aguinaldo ang pinakamatandang nabuhay na pangulo ng Pilipinas, na namatay sa edad na 94.

12. Larry Bird was a versatile forward and one of the best shooters in NBA history.

13.

14. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

15. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

16. Baby fever can affect people of various ages, backgrounds, and genders.

17. Climbing without proper equipment is incredibly risky and dangerous.

18. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

19. "Bawal magtapon ng basura rito," ani ng bantay sa parke.

20. Ang tubig-ulan ay maaaring magdulot ng pagpapakalma at kapanatagan sa mga tao dahil sa tunog ng ulan at sariwang hangin.

21. Sa pagkain ng pulotgata, mahalaga na maghugas ng kamay upang hindi magkalat ang tamis sa ibang bagay.

22. My coworkers threw me a surprise party and sang "happy birthday" to me.

23. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

24. Gracias por hacer posible este maravilloso momento.

25. Nag-email na ako sayo kanina.

26. Umalis siya papuntang Cebu kahapon ng hapon.

27. Ehehe. Siya yung boyfriend ko.

28. Bagamat naghihirap ay alaga siya ng ama't ina sa masasarap na pagkain.

29. Linggo ng umaga at ang palengke ay siksikan.

30. To break the ice at a party, I like to start a game or activity that everyone can participate in.

31. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. It can be helpful to get feedback from beta readers or a professional editor

34. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

35. Nais sana kitang isama subalit hindi talaga maari ang mga kagaya ninyo sa aming kaharian.

36. She's always gossiping, so take what she says with a grain of salt.

37. Danau Toba di Sumatera Utara adalah danau vulkanik terbesar di dunia dan tempat wisata yang populer.

38. Kumaripas si Lito nang makita niyang naglalakad na papalapit ang guro niya.

39. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

40. Paano kayo makakakain nito ngayon?

41. The company decided to avoid the risky venture and focus on safer options.

42. TikTok has become a popular platform for influencers and content creators to build their audience.

43. Kanina ka pa? tanong ni Aya sa akin.

44. Laughter is the best medicine.

45. Tumawa nang malakas si Ogor.

46. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

47. Hindi niya namalayan na tatlong oras na siyang tulala sa harap ng kanyang computer.

48. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

49. Tinignan ko siya sa nagtatanong na mata.

50. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

Similar Words

MendiolakendiunattendedgirlfriendboyfriendbestfriendfriendlegendduwendelegendsmeriendaendingspendingfriendstrasciendeAmendmentindependentlyamendmentslegendaryblendTenderenduringselvkørendekendtvelståendevelfungerendeførendeEndvidereomfattendeEndeligvedvarendedependlending:lendLendinglender,Depending

Recent Searches

badendbirthdayuniversalbinilingikinalulungkotngumitikomedornanahimiknananaghilinaghihiraptahimiktog,usuarionaninirahanbilitangangraphicreachsiyamargueseniorencompassesburmaalas-dosguiltymagta-taxiipagtimplanagtaasserviceswhynakapaligidbagkusnaglalakadna-fundincluirlabornakasumagotbreaksatisfactionexpectationsfraomelettepootbarangayphilippinemakapangyarihangkalalakihanalas-diyeskasuutanpagtutolmarurumipagpapatubonagkakakainanumangaustralianagtagpobotongnapakamethodsexplainquicklyalignsoffentlighimselfpeaceiiwanpundidocultivationcualquierengkantadangressourcernenagpapaigibpangyayariitokarunungandahan-dahancarsnagtutulakpacienciaibat-ibangkumidlatnawawalainspirationsurveysalanganpinansinpersoninspirebanlagentertainmentbunutanahasbrasoantoksellingpalayaniyacomputere,busyblusahydelunderholderbuslocomienzangranadaballbelievednathansorrytenincludefacultycablebeginningnilutotanimibalikingatanbarogrinsbansapag-aaralangnagdudumalingsuccessnapaplastikanmurang-muranagulatpinakamatabangmarketplaceslihimginawarankaninonovellesmabihisanmakasakayi-rechargenakadapanabighanipanghabambuhayendviderenatakotmisyunerongpinisilincitamenternakabiladmalilimutanengkantadakanayangipinambilihoynatagalanmayabongnapapikitlabahinsentencebestkulotcarmenadvancebuslacksumalidyanbarrierssteerhimigeyeparatinginalismessagegenerateddumaramiprovidedmediummarunongfatalitemschoicepaghaharutanparehongeksaytedmaghahandatasacolordilawbarung-barongmagpapabunottanongsasagutinnagmadalingkahariansinasadyapaglulutolabinsiyamnalangpaliparinnalalabisasagot