Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "end"

1. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

2. Eksporterer Danmark mere end det importerer?

3. Fra biler til fly til tog, teknologi har gjort det muligt for os at bevæge os hurtigere og mere effektivt end nogensinde før

4. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

5. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

6. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

7. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

8. The construction of the building required a hefty investment, but it was worth it in the end.

9. The laptop's hefty price tag reflected its powerful specifications and high-end features.

10. The movie was absolutely captivating from beginning to end.

11. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

Random Sentences

1. The CEO received a hefty bonus for successfully leading the company through a period of growth.

2. Ani Karing ay naiinggit ito kay Bereti dahil nakukuha ang lahat ng gusto.

3. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

4. Naglalaro kami ng 4 pics 1 word sa cellphone.

5. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

6. Ang panitikan ay may kakayahan na magbukas ng ating isipan sa iba't ibang kaisipan at ideya.

7. Actions speak louder than words.

8. Sa gitna ng pagdiriwang, naroon pa rin ang kanyang hinagpis na pilit niyang itinatago.

9. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

10. Doble kara ang tawag sa mga balimbing na tao

11. Ang pagsusuri ng wastong hudyat ay mahalaga sa interaksiyon ng tao at sa pag-unawa ng iba't ibang anyo ng komunikasyon.

12. He blew out the candles on his birthday cake and made a wish.

13. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

14.

15. Naglipana ang mga ibon sa hardin ngayong tag-araw.

16. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

17. Nagbabakasyon ako sa beach kasama ang pamilya kaya masayang-masaya ako ngayon.

18. La música puede ser una carrera lucrativa para algunos músicos.

19. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

20. Maging ang mga diyosa ay kanyang hinamak na wala na ngang makahihigit pa sa galing niya.

21. El invierno se caracteriza por temperaturas frías y, a menudo, por nevadas.

22. High blood pressure is more common in older adults and those with certain medical conditions.

23. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

24. Aling bisikleta ang gusto niya?

25. Ano ang ikinagalit ng mga katutubo?

26. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

27. Eine klare Gewissensentscheidung kann uns helfen, unser Leben in Einklang mit unseren Überzeugungen zu leben.

28. Si Juan ay napakagaling mag drawing.

29. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

30. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

31. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

32. His administration pursued a more confrontational stance towards countries like China and Iran.

33. Halos hindi niya narinig ang halingling ni Ogor.

34. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

35. Las vacaciones son una oportunidad perfecta para desconectar del trabajo.

36. Berapa harganya? - How much does it cost?

37. Sí, claro, puedo confirmar tu reserva.

38. Maraming bagay ang kailangan isaalang-alang sa pagpaplano ng kasal, tulad ng budget at mga bisita.

39. We didn't start saving for retirement until our 40s, but better late than never.

40. Lumapit ang matandang babae at ipinahayag ang kanyang hinagpis dahil sa kawalang-katarungan.

41. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

42. Nag-iisa kasing anak si Ranay.

43. Saan ka nakatira? ang tanong ng pulis.

44. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

45. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

46. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

47. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

48. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

49. Gusto naming makita uli si Baby Janna eh. si Maico.

50. Lumalaon ay dumarami ang tao sa paligid at ang pulis na umuusig ay tila siyang-siya sa kanyang pagtatanong at pagsusulat sa kuwaderno.

Similar Words

MendiolakendiunattendedgirlfriendboyfriendbestfriendfriendlegendduwendelegendsmeriendaendingspendingfriendstrasciendeAmendmentindependentlyamendmentslegendaryblendTenderenduringselvkørendekendtvelståendevelfungerendeførendeEndvidereomfattendeEndeligvedvarendedependlending:lendLendinglender,Depending

Recent Searches

dividesplanendmovingbabamapadalikahusayanpaki-drawingpayongmagtatanimsinisinagbabakasyonrektanggulogayunpamancovidmakilalalibagjerrytindaminamahalandremarieltag-arawpinagkaloobanbloggers,sagotsequerelomiyerkolestaoperoisinarabobomasayaeditorpinagmamalakiminahanpaparusahaniloilocertainlcdmommynalalamanmakakakainahhhhpaglayasulonyesisidlanestudyanterequiretiyapagtawakatuladfactoresasukalisugapagtuturolumiwanagextraeffektivnaglipanangrevolucionadopagkalungkotbayaninghinampascompostmagtanimwhilenakatulogmakespersistent,alignsrepresentedpabigatglobalisasyonreachtumirapakakasalanmeetpundidomalapalasyoisangadvancedmagworkhalinglingpakanta-kantangnuevosharmfulnuevotumamanagbigaycrucialhusohundredmetrobiniliitinulosbunutancommercialrailandzoompingganinteligentesdeclaremuchechavenamanmakapaibabawdi-kawasamagpa-picturetagtuyotnakayukonakuhangbinibiyayaanmangangahoymagpalibrenagpapaigibressourcernesalu-salomasasamang-loobtanodpaungolintensidadhawaiimaibibigayvideospaghalikbiyassuotpilingkundimaya-mayapesopagpalittalinolikodpinunitbitawankikonagtakakalayuantinawagbintanagasolinasinagotkruskapatawaranibinaonsamakatwidmusicianspagtiisandebatessecarsenakatinginwhetherpinipilitpnilitlupainbilanggoconvertingdasaltinderahumblepamamasyaldamdaminnothingkaragataninventadonakaakyatsagingkapalnagtataasdaysadvancementinstitucionesinventionhagdanexamplefacilitatingmatatresjuegosengkantadangnakauwio-orderbumangonincreasinglybinibilikinauupuangbusiness:finishedinilabaskumidlatangkopandrespanindangestilosdisyempre