Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "energy"

1. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

2. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

5. Dancing all night at the club left me feeling euphoric and full of energy.

6. Eating a balanced diet can increase energy levels and improve mood.

7. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

8. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

9. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

10. Electric cars can help reduce dependence on foreign oil and promote energy independence.

11. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

12. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

13. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

14. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

15. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

16. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

17. Not only that; but as the population of the world increases, the need for energy will also increase

18. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

19. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

20. Tesla is an American electric vehicle and clean energy company.

21. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

22. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

23. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

24. The scientific community is working to develop sustainable energy sources to combat climate change.

25. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

2. Mange steder i Danmark afholdes der påskeoptog og andre offentlige begivenheder i løbet af Holy Week.

3. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

4. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

5. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

6. The dog barks at the mailman.

7. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

8. Ang tagumpay ng kanilang proyekto ay lubos na ikinagagalak ng kanilang grupo.

9. Bagai pungguk merindukan bulan.

10. Las plantas nativas son especies que se encuentran de forma natural en un determinado lugar y son importantes para la conservación de la biodiversidad.

11. Oy oy! Tama na yan baka maaksidente tayo!

12. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

13. Sa purgatoryo, inaalis ng Diyos ang mga natitirang kasalanan sa mga kaluluwa bago sila tanggapin sa Kanyang harapan.

14. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

15. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

16. Ang tula na isinulat niya ay ukol kay Romeo na matalik niyang kaibigan.

17. Soto ayam adalah sup ayam yang dimasak dengan rempah-rempah Indonesia khas.

18. Na-suway ang batang lalaki nang hindi umuwi sa oras na itinakda ng kanyang magulang.

19. Nagandahan ako sa pagtatapos ng libro.

20. Nahulog ang saranggola sa puno ng mangga.

21. The company's CEO announced plans to acquire more assets in the coming years.

22. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

23. Ang ganda ng bagong laptop ni Maria.

24. Naghingi ako ng pahintulot na hiramin ang mga kasangkapan sa kusina para sa aking cooking class.

25. Nationalism is a political ideology that emphasizes the importance of the nation-state.

26. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

27. El cultivo de frutas tropicales como el plátano y la piña es común en países cálidos.

28. En la realidad, las cosas no son siempre en blanco y negro.

29. Bwisit ka sa buhay ko.

30. Bumalik siya sa Pilipinas kasama ang suporta ng mga Amerikano noong 1898.

31. Wala yun, gusto ko rin naman sanang pumunta dito eh.

32. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

33. They do not skip their breakfast.

34. Naku, may boyfriend ako eh. sabi ko.

35. He admired her for her intelligence and quick wit.

36. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

37. Si Jose Rizal ay napakatalino.

38. Kailan ipinanganak si Ligaya?

39. Einstein was an accomplished violinist and often played music with friends and colleagues.

40. Hindi pa namin napapag-usapan eh. sagot niya.

41. The bride and groom usually exchange vows and make promises to each other during the ceremony.

42. Masanay na lang po kayo sa kanya.

43. Kung hei fat choi!

44. Cheap sunglasses like these are a dime a dozen.

45. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

46. Ang sigaw ng matandang babae.

47. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

48. Muli niyang tiningnan ang nakabulagtang si Ogor.

49. If you think she'll forgive you, you're barking up the wrong tree.

50. Algunas personas coleccionan obras de arte como una inversión o por amor al arte.

Similar Words

energy-coal

Recent Searches

nocheenergytamadmauboskinarolandiskedyulpatunayankingdomgodtayokolookedinvitationbuntisasiaticincidencewaterituturoinfluencesalways1787hidingmassesipinadalalegislationingatancapitallaryngitisnaycalciummalambingokaybalancesinischarminghanbranchesmapuputipookpulacoaching:animoknow-howfridaychadso-calledipagbilipedrootrasparagraphsbroughtredesleytemagpuntamagdaconnectingsnobgearbukadoscouldrelativelycakedevicessedentaryeksaytedbubongchambersbustransitmayorgitnayumabonginsteadtechnologyguidejunjunelectedhelloroughheldaggressionreadingonlyfredipongyakapbastonhesukristotag-ulantagalogdemocraticinteragererbusinessesmahabaenergiumuwingmeaninghowevernanghihinaadversenasiyahanpanamakarapatangforcessahodumibigpagkaganda-gandayoungnalulungkotpublishedlamangnakagalawmangangahoypoliticaladobomahawaankinagalitanmagulayawtextokaraokebayanisersilangmagtatanimpagkainisipinatawagngititongniyoisinalaysayabalangsoundpasasalamatcampaignsbinibinidumarayolalodrayberdalandanduribagofardowngenerabadinaananstayyelohydelendvideresantoscommunicationsregularrevisesourcepowersplagaspakpakmalakasnaubosnatutoengkantadanatingtilinahawadumimunangmemorymatabamasterlumangmatagalmakulongtumabilangyalangitcomputerhintuturolangawlalongkitangdyanaksidentekaramiworryabstainingkapainjulietpalayandatingjosephdalanginamincausesgawainbevareitimworkdayganangbecame