Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "energy"

1. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

2. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

5. Dancing all night at the club left me feeling euphoric and full of energy.

6. Eating a balanced diet can increase energy levels and improve mood.

7. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

8. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

9. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

10. Electric cars can help reduce dependence on foreign oil and promote energy independence.

11. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

12. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

13. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

14. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

15. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

16. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

17. Not only that; but as the population of the world increases, the need for energy will also increase

18. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

19. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

20. Tesla is an American electric vehicle and clean energy company.

21. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

22. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

23. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

24. The scientific community is working to develop sustainable energy sources to combat climate change.

25. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Nagsagawa ng seminar ukol kay Marites sa pangangalaga niya ng kalikasan.

2. The team’s momentum shifted after a key player scored a goal.

3. Helte kan have en positiv indflydelse på hele samfundet.

4. Tolong jangan lakukan itu. - Please don't do that.

5. Sadyang maganda ang panahon ngayon kaya't magpi-picnic kami sa park.

6. She decorated the cake with colorful sprinkles and frosting.

7. Tengo tos seca. (I have a dry cough.)

8. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

9. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

10. Nanghiram ako ng pera sa kaibigan ko para may panggastos sa kape.

11. May pitong araw sa isang linggo.

12. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

13. Keep practicing and hang in there - you'll get better at it.

14. Das Gewissen ist ein wichtiger Faktor bei der Entscheidungsfindung in schwierigen Situationen.

15. Hindi nga ba't meron din daw siyang mga pakpak tulad nila.

16. Nabigla ako sa tanong nya kaya sinapak ko sya.

17. Over-emphasis can be counterproductive and may undermine the intended message.

18. Sa tulong ng mga batang nagsilapit, ang matanda ay nakatindig.

19. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

20. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

21. Sa ganang iyo, mahalaga pa ba ang kultura at tradisyon sa modernong panahon?

22. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

23. Kapag dapit-hapon, masarap kumain ng merienda habang nagmamasid sa sunset.

24. Nakakasama sila sa pagsasaya.

25. Si Ogor ang kinikilalang hari sa gripo.

26. Biglang nagtinginan sila kay Kenji.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Magandang-maganda ang pelikula.

29. El que espera, desespera.

30. Ang saya ng Pinoy fiesta, lalo na kapag may parada at sayawan.

31. Pagkatapos ng misa, nagbigay ang pari ng mga panalangin para sa mga kaluluwa sa purgatoryo.

32. The hospital had a special isolation ward for patients with pneumonia.

33. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

34. La paciencia nos da la fortaleza para seguir adelante.

35. En España, el cultivo de la vid es muy importante para la producción de vino.

36. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

37. Mahalagang magkaroon ng emergency fund upang maiwasan ang pagkakaroon ng utang sa panahon ng krisis o emergency.

38. Ang mga paaralan ay maaaring magpakalat ng kamalayan sa mga mag-aaral tungkol sa panganib ng paggamit ng droga.

39. Kebahagiaan adalah hasil dari kepuasan, keseimbangan, dan rasa bersyukur atas apa yang kita miliki.

40. Nawala yung antok ko. May pumasok na evil plan sa utak ko.

41. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

42. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

43. Oh! What a coincidence, dito ka pala nagtatrabaho?

44. Nang tayo'y pinagtagpo.

45. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

46. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

47. Hindi ako usually ganto, pero sana pwede ba kita makilala?

48. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

49. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

50. Hinugot niya ang kanyang bag sa ilalim ng mesa.

Similar Words

energy-coal

Recent Searches

nakakitakatagangenergyfriendskaninafilmsbalitapinakamatabangyouthbirthdaykanginanamilipiteksempelsiramagkasintahannakagawianmayabangnakatinginflyvemaskinerrenacentistanaiisipharapancapacidadpagkataposbuung-buoipagbilinaminperlaellaabutanparehongmatagpuanjingjingmejomataaasleytepelikulatsismosanasaangnatatanawmonumentohastaanghelmakuhaorkidyaskasaysayanhadnabighanidemocracymahahawarailhimignaritodisyemprebyedaystreamingadoptedginangumokayclientesparagraphsumiiniti-rechargepumayagnagtalagabairdadicionalesmaaarimataraytillberegningerproducirinuminnagmistulanglayout,wordsutilizabalediktoryanpagputinagbibigayanarmedbulasasakaypaskongpinalayaspaslitlacktagaroonmagnakawtumamawalletpamumunoabut-abotcreationnatakotsumasayawpdamahirapusingcontestclassespangulomethodsproperlynalugmok11pmcorrectingpagpasensyahanmrsnakaliliyongdalaganggalakpamamahingaleadersmaanghangcleardapit-haponpalitanmumuntinghardingregorianonakakagalingnoonmeriendasiguradofurymagpaniwalapumuntaitemsmourneddespitenaghanappagbatikanluranmaintindihanamericawednesdaybilugangnakabulagtangmagbasaprincipalesimporyancocktailkumakantaisinumpavivatondoumuulanrightsuponconditionbakabroughthappenedowndiretsogoalnangahaskamandagbooksorderinunibersidadnaawaelenaafterjobmatandangsharmaineganidconstitutionpahabolconsistkasipetsangmakikitafathernapakabagalkayipagtimplanovellesnapabayaannatuloymilyongrevolutioneretpagtingintransparentnakaiyanumiiyakinfectiousteleviewinginiirognagulatcollectionsrolledpaksaestablishedpalda