Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

52 sentences found for "our"

1. "Dogs are not our whole life, but they make our lives whole."

2. "Dogs come into our lives to teach us about love and loyalty."

3. A lot of noise from the construction site disturbed our peace and quiet.

4. A lot of traffic on the highway delayed our trip.

5. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

6. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

7. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

8. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

9. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

10. Einstein's theory of general relativity revolutionized our understanding of gravity and space-time.

11. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

12. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

13. Forgiveness allows us to let go of the pain and move forward with our lives.

14. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

15. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

16. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

17. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

18. I admire my mother for her selflessness and dedication to our family.

19. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

20. I'm going to surprise her with a homemade cake for our anniversary.

21. It may dull our imagination and intelligence.

22. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

23. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

24. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

25. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

26. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

27. Los sueños son la manifestación de nuestra creatividad y nuestra capacidad de imaginar un futuro mejor. (Dreams are the manifestation of our creativity and our ability to imagine a better future.)

28. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

29. May I know your name for our records?

30. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

31. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

32. Our relationship is going strong, and so far so good.

33. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

34. Scientific discoveries have revolutionized our understanding of genetics and DNA.

35. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

36. The acquired assets will help us expand our market share.

37. The airport was busy, and therefore we had to arrive early to catch our flight.

38. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

39. The scientific community is constantly seeking to expand our understanding of the universe.

40. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

41. We admire the courage of our soldiers who serve our country.

42. We didn't start saving for retirement until our 40s, but better late than never.

43. We finished the project on time by cutting corners, but it wasn't our best work.

44. We have finished our shopping.

45. We need to optimize our website for mobile devices to improve user experience.

46. We need to reassess the value of our acquired assets.

47. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

48. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

49. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

50. We've been managing our expenses better, and so far so good.

51. When we read books, we have to use our intelligence and imagination.

52. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. May problema ka ba? Kanina ka pa tulala eh..

2. Maging ang mga mahihirap na disenyo ay kaya ng gawin ng bata sa murang edad.

3. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

4. No te alejes de la realidad.

5. Sa pagsasagawa ng outreach program, ang bayanihan ng mga organisasyon ay nagdulot ng pag-asa at pag-asa sa mga benepisyaryo.

6. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

7. Marahil ay nasa kabilang dako ng mundo ang taong mahal mo kaya't hindi kayo nagkikita.

8. Pasensya na, masama ang pakiramdam ko.

9. La science est la clé de nombreuses découvertes et avancées technologiques.

10. Di mo ba nakikita.

11. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

12. Dahil sa patuloy na pagtitiyak sa kalidad ng mga produkto at serbisyo, yumabong ang negosyo ng isang kumpanya.

13. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

14. Les motivations peuvent changer au fil du temps, et il est important de s'adapter à ces changements pour rester motivé.

15. Maaga kaming nakarating sa aming pupuntahan.

16. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

17. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

18. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

19. Ang lalaki ng isdang nahuli ni itay.

20. Mon mari a fait une surprise pendant notre cérémonie de mariage.

21. I do not drink coffee.

22. El algodón es un cultivo importante en muchos países africanos.

23. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

24. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

25. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

26. Palibhasa ay may malalim na pag-unawa sa mga komplikadong konsepto at ideya.

27. Tinatawag niya ang anak ngunit walang sumasagot.

28. A balanced and healthy diet can help prevent chronic diseases.

29. Maaaring magbigay ng libro ang guro sa akin.

30. Nang tayo'y pinagtagpo.

31. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

32. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

33. Hinawakan ko siya sa may balikat niya.

34. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

35. Yung totoo? Bipolar ba itong nanay ni Maico?

36. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

37. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

38. Nagpunta ako sa may kusina para hanapin siya.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

41. Naging kaibigan ko ang aking guro sa Sining dahil sa aming parehong hilig sa art.

42. Busog pa ako, kakatapos ko lang mag merienda.

43. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

44. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

45. The love that a mother has for her child is immeasurable.

46. Ipinagbabawal ang marahas na pag-uusap o pagkilos sa paaralan.

47. Mag-iikasiyam na nang dumating siya sa pamilihan.

48. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

49. Pangkaraniwang Araw sa Buhay ng Isang Tao

50. Sino ang kasamang kumanta ni Katie?

Similar Words

yourcoloursourcessourcecoursesresourcesCourtfourmournedressourcerneyourself,discouraged

Recent Searches

wellcoachingourdogbalesinongalamkokakumiilingfradollyabonomabilisbernardobagyoubodginagawaoverallmapayapatakeakinpasensiyacorrectinganimreddancepaslitcigarettebituindifferentstructureayankasingbasauniquechefcontinuedhapasintubignapaiyakpatininadelmumuramanalomaaliwalasproducererbukakainspirepatutunguhannakatirangdilimkayangmetropag-aalalaewanaayusinsinulidmalisandoble-karapaungolnakakainpokerincidencepaglingonwriting,combatirlas,naguusaptelecomunicacionesnabiawangwindowtonggamepromotinganipedejackymarsobinibiyayaanobra-maestrakapangyarihannakatayonegro-slavesinakalangnalagutandumagundongminu-minutopinapasayasumungawanthonymaligayagagamitunosbefolkningen1970shabitsmagsunogmatikmanmagpa-picturepamahalaannecesariokinasisindakanmaisusuotdeliciosanandayanagdadasalmagbalikpagbabayadtv-showsnagsuotkaninumanreboundnahulogpeksmanmabatongkasamaangmaibibigayvidenskabnagpalutocementsouthnaiwangomfattendedisciplinhinampaspayongpauwimerlindawednesdayipagmalaakiexpeditedkakayanangbulongbumangontibokapoynogensindelipadbumiliaaisshestilosaidbutihingmaluwangblazingnunoisinalangvelstandreachjosemapagkalingaspeechespartybobobrindarmagdaasimhugisroseriskmarchsumugodvampirespagbahingtuminginabanganmakapalloloprogramaanothergitanasulinggenerationsstatepowersbehindrolledtrainingpopulationkamalianmangingisdakatotohananlitsonpotaenakinantatondopagkataposcomputerabalasorrygayunpamansumingitcuentankisapmatapayninyonausalniyogmagnakawsabadong