Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "individual"

1. Cancer can impact not only the individual but also their families and caregivers.

2. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

3. Many financial institutions, hedge funds, and individual investors trade in the stock market.

4. The United States also has a system of governors, who are elected to lead each individual state

5. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

6. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

7. The United States has a system of federalism, where power is divided between the national government and the individual states

8. The United States is a federal republic, meaning that power is divided between the national government and the individual states

9. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

Random Sentences

1. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

2. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

3. Confocal microscopes use laser technology to create 3D images of small structures.

4. Naramdam ng pagkaawa si Mang Kandoy kaya't agad niyang binato ng isang piraso ng matigas na kahoy ang tigre upang malihis ang atensyon nito sa usa.

5. Has she read the book already?

6. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

7. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

8. Sino-sino ang mga kaklase ni Carmen?

9. It is brewed from roasted coffee beans, which come from the Coffea plant.

10. La música también es una parte importante de la educación en España

11. Einstein's work also helped to establish the field of quantum mechanics.

12. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

13. Nationalism is often associated with symbols such as flags, anthems, and monuments.

14. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

15.

16. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

17. Ang haba ng prusisyon.

18. Representatives can be found at various levels of government, such as local, regional, national, or international.

19. Sige maghahanda na ako ng pagkain.

20.

21. Bakit ka nakitulog sa bahay ng kaibigan mo?

22. Binantaan ng mga sibilyan ang magnanakaw bago ito tumakas.

23. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

24. She attended a series of seminars on leadership and management.

25. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

26. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

27. Hindi ko alam kung may chance ako, pero sana pwede ba kitang mahalin?

28. Ang mumura ng bilihin sa divisoria.

29. Ang gubat ay puno ng iba't ibang magaganda, makukulay, at mababangong mga halamang namumulaklak.

30. He also believed that martial arts should be used for self-defense and not for violence or aggression

31. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

32. Matapos ang matagal na paghihintay, ang aking pag-aalinlangan ay napawi nang dumating ang inaasam kong pagkakataon.

33. Nagsisilbi siya bilang chef upang magluto ng masarap na pagkain para sa kanyang mga kustomer.

34. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

35. Sa bawat desisyon na ating ginagawa, kailangan nating isaalang-alang ang bawat posibilidad, samakatuwid.

36. Los fertilizantes orgánicos son utilizados en el cultivo ecológico para enriquecer el suelo.

37. Sayang, kenapa kamu sedih? (Darling, why are you sad?)

38. El cultivo de hortalizas es fundamental para una alimentación saludable.

39. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

40. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

41. Hindi na nakita ni Aling Rosa si Pinang.

42. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

43. Il existe un certain nombre d'organisations et de programmes qui offrent de l'aide aux personnes luttant contre la dépendance au jeu.

44. Det er en vigtig del af vores moderne liv, og det har haft en stor indvirkning på måden, vi lever, arbejder og kommunikerer på

45. Dalawa ang pinsan kong babae.

46. Mataas sa calcium ang gatas at keso.

47. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

48. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

49. Some fruits, such as strawberries and pineapples, are naturally sweet.

50. Ang bunga ng kakaibang halaman at tila ba kamay na nag-iimbita.

Similar Words

individuals

Recent Searches

individualestadospoongjeepneynakasahodhabitempresasallepanindakaarawansaanglupacitymarahasmagta-trabahoactorgaanobuenaestarsabadongbingipakikipagbabagpakainnakatapatumiimikmakapangyarihangilangweresundhedspleje,sementongtinanggapforcesmasasabifireworkspag-uwikamisetakinamumuhianitinuringkastilangnaismakinangpaglalabadanagpepekemendiolahetoandreaiikliallergynag-aralmaaaringthinkpaacosechassandalingmagkasamangrobinstohumihinginakatayotinikpagkalapitnatitiyaknapalingonmaintainnaawaparangisinulathangaringproductionnakatingingbarongblusatanimanpaumanhinnatandaantinutoppabalingatjuanahalabertonangahashugis-uloricoresumeneducationkundimankonsultasyonkansermadridpulubikahariankaybiliskwebapakilutobagamaninumancommunicationsgoshlamanlateriloilograd4thpagiisipsagasaankongresosunud-sunodmagisipbathalaumiinitngumingisifionanasulyapankumaliwamatandang-matandalakingpepereorganizingjocelyndaannagbentananditopalibhasachavitsabogklasrumgabeeroplanongpuntamovingmagpuntamapaikotsumagotkotsecitizennakatirasasakaypatpatbotoboybagkuspanginoonprospermasinoppocapatricknegativenagsimulakerbmanananggalincreasesstrategiesmahalagaexplainfindtumangominu-minutokulogsinaliksikdinaluhanbumibitiwbecomemabaithinabolhikinglandekamalayanlagaslaskasakitbuung-buowidelyhinihintaypagbibirorevolutioneretfitwastesinehanmasipagibaliknakakagalakurakotbutodyipnipaglakinakukuhabevareporluzaniyatotoohouseholdmangungudngodkitang-kitapersonproductividadloansmatsingmulighederlandnito