Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "large"

1. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

2. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

3. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

4. Making large purchases without consulting your budget is a risky move.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

7. The store has a variety of sizes available, from small to extra-large.

8. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

Random Sentences

1. Muntikan na syang mapahamak.

2. Lalong nagalit ang binatilyong apo.

3. The park has a variety of trails, suitable for different levels of hikers.

4. Ano-ano pa po ang mga pinaggagagawa ninyo?

5. The acquired assets were key to the company's diversification strategy.

6. "Dogs are like potato chips, you can't have just one."

7. El acceso al agua potable es un derecho humano fundamental.

8. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

9. Gusto ko na umuwi ng Pilipinas.

10. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

11. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

12. Hindi umimik si Aling Marta habang minamasdan ang bata.

13. Ang aking teacher ay hindi muna nagturo ngayong araw.

14. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

15. Madalas lasing si itay.

16. They are attending a meeting.

17. Madilim ang kweba na kanilang pinasok.

18. Motion er en vigtig del af en sund livsstil og kan have en række positive sundhedsmæssige fordele.

19. Kung may tiyaga, may nilaga.

20. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

21. Magsusunuran nang manukso ang iba pang agwador.

22. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

23. Ang carbon dioxide ay inilalabas ng mga tao.

24. En invierno, las temperaturas suelen ser bajas y el clima es más fresco.

25. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

26. Dahil alam niyang galit na ang kanyang ina ay di na umimik si Pinang.

27. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

28. Happy Chinese new year!

29. She has been running a marathon every year for a decade.

30. Bumuga na lang ng hangin si Maico saka tumingin kay Mica.

31. Påsken er en tid, hvor mange mennesker giver til velgørende formål og tænker på andre, der har brug for hjælp.

32. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Humingi siya ng makakain.

35. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

36. Vi skal fejre vores helte og takke dem for deres indsats.

37. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

38. Ano ang pangalan ng hotel ni Mr. Cruz?

39. Hindi masikmura ni Lando ang ginawang kasamaan ng kanyang kaibigan.

40. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

41. Hindi mo matitiis ang mga maarteng tao dahil sobrang pihikan sila.

42. We have cleaned the house.

43. Siguro ay may kotse ka na ngayon.

44. Gigising ako mamayang tanghali.

45. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

46. Matapos mahuli, nanumpa siya ng katapatan sa Estados Unidos.

47. Nasawi ang drayber ng isang kotse.

48. Børn skal beskyttes mod vold, misbrug og andre former for overgreb.

49. Huwag daw siyang makikipagbabag.

50. Les patients sont souvent mis sous traitement médicamenteux pendant leur hospitalisation.

Similar Words

larger

Recent Searches

largecalidadcelularesinvolvericohila-agawankapeibinubulongdyipmoderneimpitwakasfiancepamahalaanthenkumatokpaki-chargemaipapautangwalkie-talkiemarionagsimulakilaydiinnakakatulongsementongpaga-alalalumiwagflavioika-50landenamevitaminnagpakitapinipisileffektivgenekamiashaponbelievedlugawhumihingipitonagwagitatlotwocreationsabogcualquierstudentlazadatayobaryobinge-watchingmagselossakalingnagmistulangisulatkapatidguiderecentkahusayanneed,bulasizerequirelulusogstrategiesdecreasemedievalpaskongstruggledpulang-pulaconsiderdumatingnagnakawxixsystems-diesel-runamendmenttiemposregulering,kelancuentanabspagluluksanakaraanganyanpaglakipinapataposinasikasobesessalatnamanhealthieryanogsåhotelfreelancercultivareskwelahankampanaaffiliatediseasessingaporekuwartoindiakuwentobangkangkuwadernofestivalesdesisyonannag-aalangannakilalaseasontalenthetobukodnatanongpagkagisinghinagud-hagodipapainitbuung-buoikinakagalitanopalakaiguhitnakahugnewsnakatagomag-amasiyudadgymika-12pantalongpagkaimpaktosumakaypatidakilangyumaomagpahaba2001mobileplasamangangalakaldalawfar-reachingblusabusipagpalitinfinitykahirapanpebreronananaginippongkontingposterpasalamatanfitumigtadstandreynainventionpeeptvscallerpinaghandaanmateryalesnagpasanbalediktoryannapansinpagputinawawalanaglabamakauwisiguradotabakumakainkalakihansikippersonaldiagnosticlingidnagsamapagtiisannanaymaawaingrosaaddingartificialbitbitmahirapcontrolaclassmateclassesnakaliliyongmagpaliwanagcompositoreslapitanrestbeyondsalapi