Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "credit"

1. Ang pagbabayad ng utang sa tamang panahon ay nagpapakita ng katapatan sa pagbabayad ng mga utang at magiging magandang rekord sa credit score.

2. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

3. He applied for a credit card to build his credit history.

4. He used credit from the bank to start his own business.

5. He used his credit to buy a new car but now struggles to make the monthly payments.

6. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

7. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

8. I need to check my credit report to ensure there are no errors.

9. I reached my credit limit on the card and couldn't make any more purchases.

10. I used my credit card to purchase the new laptop.

11. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

12. It's important to maintain a good credit score for future financial opportunities.

13. It's wise to compare different credit card options before choosing one.

14. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

15. Paki-charge sa credit card ko.

16. People can also borrow money through loans, credit cards, and other forms of debt.

17. She has a poor credit history due to late payments and defaults on loans.

18. She has excellent credit and is eligible for a low-interest loan.

19. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

20. The bank approved my credit application for a car loan.

21. The credit card statement showed unauthorized charges, so I reported it to the bank.

22. The credit check for the apartment rental revealed no red flags.

23. The credit union provides better interest rates compared to traditional banks.

24. The store offers a store credit for returns instead of a cash refund.

25. They offer interest-free credit for the first six months.

26. They offer rewards and cashback programs for using their credit card.

Random Sentences

1. May problema ba? tanong niya.

2. Not only that; but as the population of the world increases, the need for energy will also increase

3. Budgeting, saving, and investing are important aspects of money management.

4. Napakaganda ng loob ng kweba.

5. Ang talakayan ay ukol kay Dr. Jose Rizal at sa kanyang mga kontribusyon sa bansa.

6. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

7. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

8. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

9. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

10. Bumibili ako ng maliit na libro.

11. A lot of laughter and joy filled the room during the family reunion.

12. Sa baguio nila napiling mag honeymoon.

13. Balak po naming bumalik sa susunod na linggo.

14. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

15. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

16. Mathematics is an essential subject for understanding and solving problems in many fields.

17. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

18. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

19. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

20. The stuntman performed a risky jump from one building to another.

21. Nangagsibili kami ng mga damit.

22. Hindi lang militar ang nakikinabang sa digmaan, maaari rin itong magbigay ng oportunidad sa mga negosyante.

23. The impact of the pandemic on mental health has been immeasurable.

24. Einstein's work led to the development of technologies such as nuclear power and GPS.

25. Upang makita niya ang babaing gaganda pa sa sumpa sa kanya, nagdala siya ng ilaw tuwing gabi.

26. Bilang paglilinaw, ang pagpupulong ay gaganapin sa online platform, hindi sa opisina.

27. The power of a single act of kindness can be immeasurable in its impact.

28. Kaagad namang nakuha ng mangangahoy ang kanyang palakol kaya't nasugatan nito ang tigre sa leeg nito.

29. Dahil sa pagkahapo ay nahiga siya sa lilim ng punung-kahoy para magpahinga.

30. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

31. Nabahala si Aling Rosa.

32. Dalawampu't walong taong gulang si Paula.

33. Nagkatinginan ang mag-ama.

34. Ang pagiging multi-talented ni Rizal ay nagpakita ng kanyang kabatiran at kagalingan sa iba't ibang larangan ng pagpapakilos.

35. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

36. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

37. Sunud-sunod na nakatalungko ang mga ito sa isa pang bangkong nas atagiliran ng nanggigimalmal na mesang kainan.

38. Sa gitna ng unos, ang kanilang mga panaghoy ay dinig hanggang sa kabilang baryo.

39. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

40. Magandang umaga naman, Pedro.

41. Sa Tokyo Olympics 2020, napanalunan ni Hidilyn Diaz ang gintong medalya sa weightlifting.

42. Iba ang landas na kaniyang tinahak.

43. We finished the project on time by cutting corners, but it wasn't our best work.

44. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

45. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

46. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

47. Gelai, siya si Tito Maico. sabi ko sabay turo kay Maico.

48. El maíz es un cultivo exigente en nutrientes, por lo que es necesario aplicar abono regularmente

49. Ano ang pinag-aaralan ni Cora?

50. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Recent Searches

iniangatpampagandamatulungincreditmabibingirenaiaanungbenefitshinugotgumisingpesosyeytusindvistibigmatipunopa-dayagonalwaiterpinalayasnapagodlihimphilosophicalalaksakimmantikareservedisasamapiginghopeviolencepasalamatanbigyanedsafitparinkahilingantokyoandresnataposboseslulusogminutesystematiskguardavotespasyanagreplyrefersdalawrockkatabingsipamorenanapatingalatradeloansbinigaykikoinulitbevarekasingtigasmukavelstandboyeasyenforcingferrerdownhalagatsaabelievedheisumapitourniyankatapatkindsmalezaawitinhihigithinipan-hipanchartscarswatawathardkadalagahangpaglapastanganbinatakgiyeralandastipidngisikababalaghangwalameronoperahanlumangoymind:bownakaraangmagbigaylordseekshapingcomplicatedipagamotmagalangnerissamotionnetflixanywherepamankaramihanmedisinarewardingafternoonpalantandaanbaku-bakongvitalaroundbangosprinsipemagkahawaknakapagsabikarwahengkakutisminatamishonestojosiebinentahanmamamanhikankutsilyoniyakinalimutanhappenedipinamilisuwailrabbahinogkainstarnamilipitpakilagaysyanagdarasalhdtvmeanngpuntaumanopigilot,makagawanaggalacardigannabiawangpiyanopagiisipvedvarendejolibeepublicationjackzfeelpatrickstateminamahalmahawaanpinakamahabakinakabahanbefolkningen,napakasipagnalalabipinahalataalbularyonanlilisiknagpalalimkinagalitankapangyarihangibinubulonghitsuramaglalakadanibersaryomerlindamagkakailanakumbinsinakatuwaangnalalamannakaluhodrelomagingpangangatawankusinerotumatanglawkahulugannakakamitkalalarokamakailanmagtiwalatinutopmagkaibangtumagalnagkalapit