Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

84 sentences found for "one"

1. "Dogs are like potato chips, you can't have just one."

2. **You've got one text message**

3. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

4. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

5. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

6. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

7. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

8. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

9. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

10. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

11. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

12. Climate change is one of the most significant environmental challenges facing the world today.

13. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

14. Don't put all your eggs in one basket

15. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

16. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

17. Football is played with two teams of 11 players each, including one goalkeeper.

18. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

19. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

20. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

21. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

22. He bought a series of books by his favorite author, eagerly reading each one.

23. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

24. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

25. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

26. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

27. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

28. He's always the first one in the office because he believes in the early bird gets the worm.

29. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

30. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

31. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

32. Hockey is played with two teams of six players each, with one player designated as the goaltender.

33. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

34. If you think I'm the one who broke the vase, you're barking up the wrong tree.

35. If you think I'm the one who stole your phone, you're barking up the wrong tree.

36. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

37. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

38. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

39. In conclusion, the telephone is one of the most important inventions in human history

40. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

41. It takes one to know one

42. It's wise to compare different credit card options before choosing one.

43. It’s risky to rely solely on one source of income.

44. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

45. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

46. Kill two birds with one stone

47. Larry Bird was a versatile forward and one of the best shooters in NBA history.

48. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

49. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

50. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

51. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

52. Limitations are the boundaries or constraints that restrict what one can or cannot do.

53. Limitations can impact one's career, relationships, and overall quality of life.

54. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

55. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

56. Musk has been named one of the most influential people in the world by TIME magazine.

57. Nationalism can inspire a sense of pride and patriotism in one's country.

58. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

59. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

60. One man, one word ka ba? Ang tipid mong sumagot eh!

61. One of the most significant areas of technological advancement in recent years has been in the field of communications

62. One of the most significant impacts of television has been on the way that people consume media

63. Put all your eggs in one basket

64. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

65. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

66. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

67. spread information and knowledge from one corner of the globe to another.

68. Television is one of the many wonders of modern science and technology.

69. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

70. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

71. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

72. The depth of grief felt after losing a loved one is immeasurable.

73. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

74. The Lakers have a rich history and are one of the most successful franchises in NBA history.

75. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

76. The stuntman performed a risky jump from one building to another.

77. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

78. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

79. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

80. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

81. Today, Amazon is one of the world's largest online retailers.

82. Today, Presley is widely considered to be one of the most important figures in American music and culture

83. Two heads are better than one.

84. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hindi ko na kayang itago ito - may gusto ako sa iyo.

3. The photographer captured a series of images depicting the changing seasons.

4. Where we stop nobody knows, knows...

5. Me encanta pasar tiempo con mis amigos jugando al fútbol.

6. Nagsasama-sama ang mga Pinoy tuwing Pasko para magdiwang.

7. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

8. En la realidad, no hay atajos para alcanzar el éxito.

9. Some fruits, such as strawberries and pineapples, are naturally sweet.

10. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

11. A couple of phone calls and emails later, I finally got the information I needed.

12. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

13. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

14. Maganda ang bansang Japan.

15. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

16. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

17. ¿Me puedes explicar esto?

18. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

19. Bumalik siya sa Pilipinas nang biglaan dahil may emergency sa kanilang pamilya.

20. Sa kabila ng mga hamon, ipinakita ni Hidilyn Diaz na walang imposible kung may tiyaga.

21. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

22. Kumaripas si Lito nang makita niyang naglalakad na papalapit ang guro niya.

23. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

24. Limitations can be a result of geographic location or access to resources and opportunities.

25. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

26. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

27. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

28. Musk has been described as a visionary and a disruptor in the business world.

29. Ibinigay ni Ana ang susi sa kanya.

30. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

31. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

32. Napakaganda ng tanawin sa dapit-hapon.

33. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

34. Maarte siya sa pagpili ng kanyang mga kaibigan kaya hindi siya basta-basta nakikipag-usap sa mga tao.

35. Nakapila sila sa kantina nang limahan para maging maayos.

36. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

37. Nous avons besoin de plus de lait pour faire cette recette.

38. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

39. Pagtatanim at pagbebenta ng gulay ang kinabubuhay ng magasawang Waldo at Busyang na parehong masipag at mabait.

40. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

41. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

42. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

43. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

44. Lumabas na ako ng cr. Nakatayo lang ako dun.

45. The company's losses were due to the actions of a culprit who had been stealing supplies.

46. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

47. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

48. Masarap at manamis-namis ang prutas.

49. Wala naman akong sinabing ayaw ko ah?

50. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

Similar Words

StonehamTonetteHonestokonekcellphonephonehoneymooniPhonegonedonemoneyHoneymoonerstelephoneemocionesconectaninstitucionesconexiconectadostelecomunicacionesfuncionesaplicacionespioneerinfusionestelefonerrevolutioneretpositionergenerationermonetizing

Recent Searches

onegraduallyjolibeenakangitijudicialmediafollowingphilippinepaglulutobagamathila-agawantumatawadmagazinesturismobundokhitsuragospellumbayhealthiertinungokaliwayumaonakaraanpanitikantumalimsabadongtinulak-tulakpinakamatabangroboticbalangalamibinaontanyagvitaminpagsidlannakakainngitidoonmanunulatflyvemaskinertawamagpaniwalatabinglegislationebidensyaawitinangkopmaliksijobsnanlalamigpangkatpaghahabibayadextremistgngmagagawanangapatdanpaaralangandakapaltradisyonkulungangayunpamandivisoriasumpunginjoeanumansunud-sunodpagkapunonaglulusakamendmentspananakitnapagtantokakaibangmagdaraosmahiyanapakagandangimportantebillpagpapakilalamalapitpneumonianaglalatangpumapasokbihiratumikimpanghabambuhaypinagsikapancomputerpundidokumatokmatutulogargueefficientpakilagaypinagkiskisokayelectoralmahinanglcdkamaypapagalitanamendmentfonoshulukagustuhangibonmakikinigchoimag-alasiikotnagngangalangipaghandarebolusyonpanalanginnaglalababumibitiwkaugnayanmobilegatasmahinalubosnagtatakanatitiyaknasagutanairportpoliticalquezonnagpa-photocopytablebridenamumulakanginamatangumpayjosiespiritualpaki-chargejenyiniibigsulingannakagalawtasanamulaklakhavemaayosparehastagapagmanaoftenandayamagdaanguronangampanyabisikletanagsusulatsumusunodprosesotuwingmasayang-masayawednesdaytumutubonagagamitsamantalangyantagaytaylaruanmonsignorlangkaykisapmatapulismedikalexecutivepagtangisusureropananakotapelyidopresidentpambatangadapagkakamalidiyabetispalikuranearlypinanawannagpadalakailanmanpagnanasamalalapaddinadasalmananakawsasapakinpaggitgittinigilantrabahobecamenatinbagamatagakiskopssspag-akyat