Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

84 sentences found for "one"

1. "Dogs are like potato chips, you can't have just one."

2. **You've got one text message**

3. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

4. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

5. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

6. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

7. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

8. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

9. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

10. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

11. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

12. Climate change is one of the most significant environmental challenges facing the world today.

13. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

14. Don't put all your eggs in one basket

15. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

16. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

17. Football is played with two teams of 11 players each, including one goalkeeper.

18. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

19. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

20. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

21. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

22. He bought a series of books by his favorite author, eagerly reading each one.

23. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

24. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

25. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

26. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

27. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

28. He's always the first one in the office because he believes in the early bird gets the worm.

29. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

30. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

31. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

32. Hockey is played with two teams of six players each, with one player designated as the goaltender.

33. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

34. If you think I'm the one who broke the vase, you're barking up the wrong tree.

35. If you think I'm the one who stole your phone, you're barking up the wrong tree.

36. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

37. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

38. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

39. In conclusion, the telephone is one of the most important inventions in human history

40. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

41. It takes one to know one

42. It's wise to compare different credit card options before choosing one.

43. It’s risky to rely solely on one source of income.

44. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

45. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

46. Kill two birds with one stone

47. Larry Bird was a versatile forward and one of the best shooters in NBA history.

48. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

49. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

50. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

51. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

52. Limitations are the boundaries or constraints that restrict what one can or cannot do.

53. Limitations can impact one's career, relationships, and overall quality of life.

54. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

55. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

56. Musk has been named one of the most influential people in the world by TIME magazine.

57. Nationalism can inspire a sense of pride and patriotism in one's country.

58. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

59. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

60. One man, one word ka ba? Ang tipid mong sumagot eh!

61. One of the most significant areas of technological advancement in recent years has been in the field of communications

62. One of the most significant impacts of television has been on the way that people consume media

63. Put all your eggs in one basket

64. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

65. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

66. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

67. spread information and knowledge from one corner of the globe to another.

68. Television is one of the many wonders of modern science and technology.

69. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

70. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

71. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

72. The depth of grief felt after losing a loved one is immeasurable.

73. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

74. The Lakers have a rich history and are one of the most successful franchises in NBA history.

75. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

76. The stuntman performed a risky jump from one building to another.

77. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

78. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

79. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

80. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

81. Today, Amazon is one of the world's largest online retailers.

82. Today, Presley is widely considered to be one of the most important figures in American music and culture

83. Two heads are better than one.

84. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

Random Sentences

1. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

2. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

3. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

4. Sa paligid ng balde, nakikia niya ang kanyang anino.

5. Lasingero ang tawag sa taong laging nag-iinom ng alak.

6. Adequate fiber intake can help regulate the digestive system and maintain gut health.

7. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

8. Nag-reply na ako sa email mo sakin.

9. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

10.

11. Ang ilong nya ay matangos naman ngunit bukaka ang mga butas.

12. Hindi naman sa ganun. Kaya lang kasi...

13. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

14. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

15. May pista sa susunod na linggo.

16. Amazon has a vast customer base, with millions of customers worldwide.

17. Ako naman, poker face lang. Hahaha!

18. Regular exercise and playtime are important for a dog's physical and mental well-being.

19. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

20. Ang daming kuto ng batang yon.

21. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

22. Marami akong agam-agam sa aking mga plano dahil sa mga hindi nakasiguraduhan sa buhay.

23. We finished the project on time by cutting corners, but it wasn't our best work.

24. Huwag daw niyang papansinin si Ogor.

25. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

26. Gusto kong bumili ng bestida.

27. Pakibigay ng tubig sa mga trabahador sa labas, mukhang nauuhaw na sila.

28. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

29. You reap what you sow.

30. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

31. Ang pagguhit ay puwedeng magbigay ng kasiyahan at fulfillment sa buhay.

32. Nous allons avoir un photographe professionnel pour immortaliser notre mariage.

33. I'm going to surprise her with a homemade cake for our anniversary.

34. Ikaw na nga lang, hindi pa ako nagugutom eh.

35. Muling nabuo ang kanilang pamilya.

36. Ang calcium ay kailangan ng ating katawan upang tumibay pa ang buto.

37. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

38. Mahalagang alamin ang interes na ipinapataw ng utang upang malaman kung magkano ang babayaran na kabuuang halaga.

39. Gusto po ba ninyong lumipat sa ibang kuwarto?

40. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

41. Bigyan mo muna ako ng dahilan kung baket. sabi ko.

42. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

43. Narinig ng mga diyosa ang kayabangan ng bata.

44. Está claro que el equipo necesita mejorar su desempeño.

45. Ngunit wala siyang nararamdaman sakit.

46. Pnilit niyang supilin ang hangaring makasilong.

47. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

48. Hinila na ni Kirby si Athena papunta sa table namin.

49. Sasagot na sana ulit ako nang lumabas ng CR si Maico.

50. When in Rome, do as the Romans do.

Similar Words

StonehamTonetteHonestokonekcellphonephonehoneymooniPhonegonedonemoneyHoneymoonerstelephoneemocionesconectaninstitucionesconexiconectadostelecomunicacionesfuncionesaplicacionespioneerinfusionestelefonerrevolutioneretpositionergenerationermonetizing

Recent Searches

oneknowalamsansanaspondonanginginigsimbahaninvolvenaminlaptoppeacematandang-matandakailanmankamaymalinisbagyonagbuntongreachingsangdeterminasyonipinadalapinilitasawatotoonglumiwanagtunaymagalangmariantagaaraw-arawuulitinpagtutolsentenceiskonagtuturolalawigankanya-kanyangsentimoslendkasamaangguerreromulikamposubjectbasahiniparatingpilipinasnakasuotpanghabambuhaytoolshubad-barocongratsgymhigantemagagandangoxygenlugardulotlumahokofrecenlungkotimpactosinasabipaglapastanganpagkikitanakatawagmatagal-tagalpang-araw-arawdelmagkitanagpamasahepandalawahanjeepneykontranaglipanapinakamasayanakapaglaronapakagalingkawawangpagkakilalafreelancing:pagpanhikmediahumarapnasulyapanpangkaraniwanmagkasamangdiliwariwlinggo-linggonapasobrapagdidilimpangkaraniwanglupanginabotmadilimmataopasyalanbanyonagpanggapmapagkalingasatinmallsmaagahierbasbumabalotbotongganyantinigdrawingpaga-alalabringuniversalbertocompletingpataybatang-batasumasayawsangkalandiyaryonagpapanggapsangkapmaliwanagperlaendeligraymondkasizoocandidateautomatiserepalakalimahanarkilahayoptilailanbangkaopportunityhitsuraclientespamilyamahuhusaypag-aanikauntihanggangkinatatakutanpinalalayaskayaschoolconsuelomakukulaybulaklakjuanawatawatnatabunanmasayang-masayakaminapaangatgraduationourkinapanayamikinabubuhaymalakaskalayaanpootisipeducativassinkbansangsusiginugunitaipinanganakkaninangmaghugasroomnanlilisiknagsisipag-uwiandinanasitinuturingbathalatangantogethertuluyanturotulalanag-away-awayhishalu-haloalikabukinbatoincomenag-asaranmatulispageantmagbabakasyonpatulogentry:speedmassestuwa