Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

84 sentences found for "one"

1. "Dogs are like potato chips, you can't have just one."

2. **You've got one text message**

3. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

4. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

5. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

6. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

7. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

8. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

9. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

10. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

11. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

12. Climate change is one of the most significant environmental challenges facing the world today.

13. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

14. Don't put all your eggs in one basket

15. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

16. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

17. Football is played with two teams of 11 players each, including one goalkeeper.

18. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

19. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

20. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

21. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

22. He bought a series of books by his favorite author, eagerly reading each one.

23. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

24. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

25. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

26. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

27. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

28. He's always the first one in the office because he believes in the early bird gets the worm.

29. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

30. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

31. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

32. Hockey is played with two teams of six players each, with one player designated as the goaltender.

33. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

34. If you think I'm the one who broke the vase, you're barking up the wrong tree.

35. If you think I'm the one who stole your phone, you're barking up the wrong tree.

36. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

37. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

38. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

39. In conclusion, the telephone is one of the most important inventions in human history

40. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

41. It takes one to know one

42. It's wise to compare different credit card options before choosing one.

43. It’s risky to rely solely on one source of income.

44. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

45. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

46. Kill two birds with one stone

47. Larry Bird was a versatile forward and one of the best shooters in NBA history.

48. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

49. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

50. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

51. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

52. Limitations are the boundaries or constraints that restrict what one can or cannot do.

53. Limitations can impact one's career, relationships, and overall quality of life.

54. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

55. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

56. Musk has been named one of the most influential people in the world by TIME magazine.

57. Nationalism can inspire a sense of pride and patriotism in one's country.

58. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

59. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

60. One man, one word ka ba? Ang tipid mong sumagot eh!

61. One of the most significant areas of technological advancement in recent years has been in the field of communications

62. One of the most significant impacts of television has been on the way that people consume media

63. Put all your eggs in one basket

64. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

65. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

66. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

67. spread information and knowledge from one corner of the globe to another.

68. Television is one of the many wonders of modern science and technology.

69. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

70. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

71. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

72. The depth of grief felt after losing a loved one is immeasurable.

73. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

74. The Lakers have a rich history and are one of the most successful franchises in NBA history.

75. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

76. The stuntman performed a risky jump from one building to another.

77. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

78. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

79. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

80. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

81. Today, Amazon is one of the world's largest online retailers.

82. Today, Presley is widely considered to be one of the most important figures in American music and culture

83. Two heads are better than one.

84. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

Random Sentences

1. Oy saan ka pupunta?! Bayad ka na!

2. Gusto ko ang mga bahaging puno ng aksiyon.

3. Tumama ang aming kapitbahay sa lotto.

4. I am absolutely excited about the future possibilities.

5. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

6. Balak kong magluto ng kare-kare.

7. Nabagalan ako sa simula ng pelikula.

8. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

9. Nagagandahan ako kay Anna.

10. Walang puno ang hindi hitik sa bunga.

11. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

12. Isinalaysay niya ang pagkapasan sa krus upang iligtas lamang ni Hesus ang mga makasalanang tao sa daigdig.

13. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

14. Napansin ni Rabona na kumakapal ang buhok nito sa katawan.

15. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

16. Ngunit tulad din ng mga ibon, tinanong nila kung bakit siya nasa kanilang kampo samantalang isa siya sa mga kaaway.

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. Ang illegal na droga ay mahigpit na ipinagbabawal sa kanilang lungsod.

19. Ice for sale.

20. Natawa ako sa maraming eksena ng dula.

21. Oh gosh. Inintay pa sya ng prince, what does it mean?

22. Kung may gusot, may lulutang na buhok.

23. Work can also provide opportunities for personal and professional growth.

24. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

25. Pagtataka ko kung bakit hindi mo pa rin napapansin ang aking mga ginagawa para sa iyo.

26. Don't cry over spilt milk

27. Anong oras gumigising si Katie?

28. Emphasis can be used to highlight a person's strengths and abilities.

29. Palibhasa ay mahilig siyang magbasa, kaya marami siyang nalalaman sa iba't-ibang paksa.

30. Sa aming tahanan sa tabing-karagatan, mahinahon ang aming buhay.

31. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

32. Sa paligsahan, ang pinakamataas na saranggola ang nanalo.

33. Bunso si Bereti at paborito ng ama.

34. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

35. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

36. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

37. Einstein's writings on politics and social justice have also had a lasting impact on many people.

38. Tumango lang ako. Wala ako sa mood na magsalita.

39. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

40. The artist painted a series of landscapes inspired by her travels.

41. Alas-tres kinse na ng hapon.

42. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

43. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

44. Pangit ang view ng hotel room namin.

45. Madalas siyang sumusulat kapag nag-iisa.

46. El maíz necesita sol y un suelo rico en nutrientes

47. Si Ana ay humanga sa disenyo ng saranggola ng kanyang kuya.

48. Sa Sabado, alas-diyes ng umaga.

49. Sa gitna ng pagdiriwang, naroon pa rin ang kanyang hinagpis na pilit niyang itinatago.

50. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

Similar Words

StonehamTonetteHonestokonekcellphonephonehoneymooniPhonegonedonemoneyHoneymoonerstelephoneemocionesconectaninstitucionesconexiconectadostelecomunicacionesfuncionesaplicacionespioneerinfusionestelefonerrevolutioneretpositionergenerationermonetizing

Recent Searches

onebayawakupangpesosnakapikitdrawingamericaikinakatwiransampungmwuaaahhumiimikafternoonnagwo-workbandangsalitangpaksabulanangingisaynapalakasumigtadnaglalabaipinagdiriwanganinatincubadiplomajeepneysmallbumibilinakatitigsabigumapangmatagalditoamazonunitedpersonasbastonpwedebatangbahagituwingpanghimagaslospowerspuedesurebuntisalwaysmagpakasalmonumentomagkaibigannauliniganmoneyphysicalcomputerebasahinganoonginugunitapanalomaskfreekailanmantanggapinkumustakangkongtindigdulotlumahoknagbungaplatformbulongkapeteryahigpitantonkaninumanpinamilinamamayatelectoralintensidadnilapatayanongpagpalitpangyayarigagbighanipagpanhiktinatawagkawili-wilinilalanglimitedimportantesplayednagdadasalpresentpresskasiyahanrobertalastahimikpatiencegaanorisknutrientsshortseangunitkaymaghugas1954nagsisipag-uwianbutilaniyalockednararapatnagtutulunganmagdidiskotinulak-tulakhacermapadelamensajesestasyonleytebumuhosimpactproudbaocompanygoodlintakutonoelpinakamatabangdelepagpapasakittagaalemalilimutinapatbiyasnag-asaranrichmatapangtugonmapaibabawpistaipakitadinglupalopbahay-bahaypinapataposteamspeedprinsipehawaiitagaytaypagsubokplagasmarianakaramdamvetosiempregregorianoleemukaconnectt-ibangkablanhabangmrsmusicianshimutokmalalimorasstaribangalammaintindihansalapibahamananakawlolounomagtrabahokanpinakawalannag-iyakannagpasyalihimnangahasnapagodsigeundassumayakutsilyopasasalamatpagdukwangestudyante