Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "fono"

1. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

4. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

5. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

6. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

Random Sentences

1. Mabuti pa makatayo na at makapaghilamos na.

2. Naaksidente si Juan sa Katipunan

3. Climate change is one of the most significant environmental challenges facing the world today.

4. Hindi ko alam kung may chance ako, pero sana pwede ba kitang mahalin?

5. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

6. The early bird catches the worm

7. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

8. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

9. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

10. The cough syrup helped to alleviate the symptoms of pneumonia.

11. Kakain ako sa kapeterya mamayang tanghali.

12. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

13. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

14. Ibinigay ng titser ang libro sa estudyante.

15. Frustration is a feeling of disappointment, annoyance, or anger that arises when we are unable to achieve a desired outcome.

16. Les travailleurs peuvent participer à des programmes de mentorat pour améliorer leurs compétences.

17. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

18. Kinuha nya yung wallet nya at inabot yung bayad.

19. Nagbasa ako ng libro sa library.

20. Nanlalamig, nanginginig na ako.

21. "Ang hindi magmahal sa sariling wika, daig pa ang malansang isda" ay isang bukambibig na nagpapahayag ng pagpapahalaga sa ating sariling wika at kultura.

22. Actions speak louder than words.

23. Nagbuntong hininga sya, Akala ko naman.

24. Frohe Weihnachten! - Merry Christmas!

25. She missed several days of work due to pneumonia and needed to rest at home.

26. Nung nagplay na, una kong nakita yung sarili ko. Natutulog.

27. Inalok niya akong sumama sa kanyang outing, datapwat may iba akong plano para sa araw na iyon.

28. No puedo controlar el futuro, así que "que sera, sera."

29. The use of emphasis is influenced by cultural and social norms.

30. Gawa ang palda sa bansang Hapon.

31. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

32. Tumamis at sumarap ang lasa ng bunga.

33. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

34. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

35. Ang sugal ay maaaring magdulot ng pagsisira sa relasyon at pamilyang pinansyal.

36. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

37. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

38. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

39. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

40. Nationalism has been used to justify imperialism and expansionism.

41. Portion control is important for maintaining a healthy diet.

42. Ang mga kasapi ng aming angkan ay nagkakaisa sa pagtatrabaho para sa kinabukasan ng pamilya.

43. Gusto kong namnamin ang katahimikan ng bundok.

44. Kailangan ng mas mahigpit na regulasyon sa mga kumpanya upang maprotektahan ang mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

45. All these years, I have been inspired by the resilience and strength of those around me.

46. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

47. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

48. Palibhasa ay may kakayahang magpakatotoo at magpahayag ng kanyang mga saloobin nang malinaw at mahusay.

49. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

50. Ang mga puno at halaman ay nag po-produce ng oxygen.

Similar Words

fonos

Recent Searches

linesumaliagosoutfonomalabomuchosstevephysicalmillionssamucoaching:imaginationdontfatpooksorryknowsnathan18thideyaavailablededication,specializedhallipinabalikpetsaresearchdeathmaaringdayshumanoskaringgalitchaddolyarmuladverselysumakitfreelancerinvestbehalfdividesdoonplanexitstagebaketrainingtiposhinagpishatingmobilestuffedaidfatalconsiderarhalikavisbeenideamagingpopulationconstantlyauthorlcdtargetyearputitooreporteducationalconectanjoycontinuesenforcingmaayosislalorenapartneroftesedentarykiloadditionallyeyemapadalinapilingrateasawaefficientusingtutorialsexamplethirdbituinsyncerrors,makapilingcomplexmediumpaceandreadulolutuinclassmateinaapisimplengdeclarenevernicemaratingreleasedworkingvansquatterslavebeforecreationuminomdarkroquepeteractionpotentialitlogcrossdosnothingdanceendnagginghispuedeisugawalangbobohigitparagraphskisapmatasinunodbrindarmadamimaawaingwordfiabinawilutopaghihirapguestspilingprocesotechnologiesnilanguniquewatchingsubjectma-buhayexistsettingeditdumaramiconvertinggitaracompletemisapootproperlybroughtmasdanharingjokeafterspentcivilizationbakitpartysufferprimerlawsmamanhikanpagkatakotkauntipamanhikansasamahannasunogindustrybilinstilleffortsfeedback,namplacemagpuntaheardawgisingbatofeltshowsown