Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "fono"

1. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

4. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

5. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

6. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

Random Sentences

1. Emphasis is the act of placing greater importance or focus on something.

2. Il est important d'avoir une compréhension des probabilités et des cotes lorsque l'on joue.

3. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

4. The bride looked stunning in her wedding dress, truly a beautiful lady.

5. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

6. Nagtatrabaho ako sa Mimosa Family Home.

7. Microscopes can be used to study the structure and function of the brain and other organs.

8. Let the cat out of the bag

9. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

10. Ada banyak komunitas pecinta kucing di Indonesia yang berkumpul untuk berbagi pengalaman dan pengetahuan tentang kucing.

11. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

12. Dapat nating isaalang-alang ang mga posibilidad ng bawat desisyon, datapapwat ay hindi natin alam ang mga mangyayari sa hinaharap.

13. Nasaan ba ang pangulo?

14. El discurso del líder produjo un gran entusiasmo entre sus seguidores.

15. The police were searching for the culprit behind the rash of robberies in the area.

16. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

17. Wag mo naman hayaang mawala siya sakin.

18. Ang ganda naman nya, sana-all!

19. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

20. The management of money is an important skill that can impact a person's financial well-being.

21. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

22. Lumbay na naman si Jose matapos matalo sa sabong.

23. Don't underestimate someone because of their background - you can't judge a book by its cover.

24. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

25. Maskiner er også en vigtig del af teknologi

26. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

27. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

28. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

29. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

30. Es común usar ropa abrigada, como abrigos, bufandas y guantes, en invierno.

31. Ano ang natanggap ni Tonette?

32. Dahil kung anong ganda ng katawan ay siya namang pagkaimpakto ng mukha.

33. Stop crying and pull yourself together, we have work to do.

34. Sino sa mga kaibigan mo ang matulungin?

35. Nationalism can also lead to a sense of superiority over other nations and peoples.

36. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

37. May nanganganib na mawalan ng trabaho dahil sa aksidente na nangyari sa paggawa ng proyekto.

38. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

39. Danmark eksporterer også mange forskellige typer af maskiner og udstyr.

40. Sa hatinggabi, maraming establisimyento ang nagsasarado na.

41. Ang sugal ay isang aktibidad na nasa ilalim ng panganib ng pagkakaroon ng adiksyon at mental na kalusugan.

42. Oo na nga, maganda ka na. Bagay sayo.

43. Makisuyo po!

44. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

45. Kumaen ka na ba? tanong niya sa akin.

46. Pedro! Ano ang hinihintay mo?

47. Sang ayon si Jose sa suhestiyon ng kanyang kaibigan.

48. Inalala nila ang mga aral na itinuro ng misyunero tungkol kay Kristo.

49. The pretty lady walking down the street caught my attention.

50. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

Similar Words

fonos

Recent Searches

fonopalayobuwisculturetinderabumabalotlivesstyrerthanksgivingmoneyricomalakastumibayshortpierunti-untingtinutopiwasanorkidyastelecomunicacionesmagawapagbibironaliligogelainai-dialmaghihintaynatuwabituindoingexistwishingcurrentpublishedemphasizedtablesettingnaiwangawaynakatuloghiwanaghuhumindighampaslupanahihiyangnagmistulangdumagundongiwinasiwaspalipat-lipattabing-dagatsponsorships,oktubreagwadoribinilidiretsahangnaapektuhanpresidentepinapalonapagtantonapipilitanpagtataaskinauupuanpulang-pulakikitanahuhumalingnagmungkahitinatawagnamulatmagnakawikinamataynaninirahannagtagisannakapagreklamomagtatagalnanghahapdikomunikasyonpinagtagpokumulogjuegosincluirgawinpeksmanpagsahodencuestasmakaraanyakapingabi-gabimaskaraikatlongpinaulananmaibigaykainitansementeryopaalamgagamitsiopaoninyonglalimadvertisingmanonoodunosnanigaspagsidlanmaestraunconventionalpresenthverlaruantinitindapinalayasthroatotherssalesilagayhastanapapikitsakaypagpasokkaraniwangnilalangnakabilad1990awitinligaligdalawinsongsexpeditedyoutubenewspapersdisenyonapapatinginnochelangkayrepublicanidiomapadabogtinitirhanknightedsajenadikyamkriskagardendreambio-gas-developingbeginningsbarrocoparangoperahanbotantenakatingingbossbinigayfeedback,contestsiempreelitehinanapgrewhalu-halomakisigkadaratingtrabahorestawanbillrailnilangrhythmibalikbatayhigitpakelamerapipinaalamgamebranchestvsearlyakowatchideyadatikumaripasnagbuwisdulababanaiinggitredbeenthereforeibabafuncionarspaghettitaon-taonmulingrememberskillamounteachuniqueleftfour