Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "fono"

1. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

4. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

5. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

6. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

Random Sentences

1. Limitations can be a result of fear or lack of confidence.

2. Lumiwanag ang lansangan dahil sa bagong ilaw trapiko.

3. Limitations can be physical, mental, emotional, financial, or social.

4. I have seen that movie before.

5. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

6. She has a poor credit history due to late payments and defaults on loans.

7. Tengo muchos amigos en mi clase de español.

8. Viruses can spread from person to person through direct contact, airborne transmission, or contaminated surfaces.

9. La labradora de mi amiga es muy obediente y siempre viene cuando la llaman.

10. Ang pelikula ay ukol kay Jose rizal na lumaban para sa kanyang bayan.

11. Uy, malapit na pala birthday mo!

12. Saan naman? Sa sine o DVD na lang? tanong ko.

13. Leonardo da Vinci fue un gran maestro de la perspectiva en el arte.

14. Limitations can be a result of societal or systemic inequalities and discrimination.

15. A couple of cars were parked outside the house.

16. Ang pangamba ay kadalasang sanhi ng hindi pagtanggap sa mga hamon sa buhay.

17. Dedication is the commitment and perseverance towards achieving a goal or purpose.

18. Si Bok ay dalawampu't siyam na taong gulang na labas masok na lamang sa bilangguan

19. At være transkønnet kan påvirke en persons mentale sundhed og kan føre til depression, angst og andre psykiske udfordringer.

20. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

21. Les écoles offrent des programmes pour aider les étudiants à se préparer aux examens d'entrée à l'université.

22. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

23. Sa Pilipinas, ang tag-ulan ay kadalasang nagsisimula mula Hunyo hanggang Nobyembre.

24. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

25. His unique blend of musical styles

26. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

27. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

28. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

29. Sino ang nagtitinda ng prutas?

30. Ang mga bata ay kailangan ng maagang edukasyon tungkol sa pag-aalaga ng kanilang ngipin.

31. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

32. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

33. Huwag kang maniwala dyan.

34. A portion of the company's profits is allocated for charitable activities every year.

35. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

36. Limitations can be overcome through perseverance, determination, and resourcefulness.

37. Anong nangyari sayo? Bakit hinde ka nagkakakain?

38. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

39.

40. Sumuway sya sa ilang alituntunin ng paaralan.

41. Sa lahat ng mga tao sa paligid ko, ikaw lang ang nais kong sabihin na may gusto ako sa iyo.

42. Magkita tayo bukas, ha? Please..

43. Really? What is he doing sa tapat ng room natin?

44. Sama-sama. - You're welcome.

45. Ngunit hindi napigilan si Magda ng kanyang mga anak.

46. He does not argue with his colleagues.

47. Some limitations can be temporary, while others may be permanent.

48. Sa aling bahagi ng pelikula ka natawa?

49. Don't put all your eggs in one basket

50. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

Similar Words

fonos

Recent Searches

fonoprospersamuperangsorryinternamaratingthoughtskitjohncommercecandidatemobilelibrebehindlumuwasbernardomastermanagerskillsetsawareallowedtechnologiesserviceselectedanotherbutigovernmentkapilingutusanexampleberkeleyknowledgemediumdifferentamazoncontrolledginootumabagagagayunpamanpalancamagtatagalnagmamadalimakahiramyumabongnakatagomagsabihumiwalayinsektongkuwadernoumakbaysakaabundantetenniskannai-dialkampanakainitanminamasdanisagarbansosprimerasagam-agamagoslaruantagalogkaminasabingshopeehapag-kainannaiwangprinsipengsinabielitededication,imaginationbaduykausapinnakikini-kinitakaaya-ayangalingumuwinaglokohanilawnaghihirapmahihirapkaysalumipadrosepagkalungkotlabinsiyammanghikayatkwartosumusulatfiverrisinawakpalasyoprosesosmilesurroundingssharetagtuyotpaumanhiniguhitapoymiralangismagsusuotnamwowofficeobstaclesconcernsbulatepaceninumanitimmaraminapakatalinonakikilalangwalkie-talkielumiwanagnagpaalammakakatakasmababawpagpapakilalasahigmahiwagamakapalagkanikanilangpahahanapdumagundongmakipag-barkadamatapobrengalapaaphumalonagdaboglumayothanksgivingmahinangnakapasahinamaknaabotlikodmatumalpapalapithagdanantelecomunicacionesgawaingbilerkumananharapane-bookspagtatakafactorespamagatnakalockisinamanuevosnabigayislandrespektivealangangagamitmbricosemocionesrequierenwakasnakapikitnagwikangitinaassampungbumalikaayusinreserbasyonmalasutlamatangumpaynuevonatutuwaresearch,bihasapagsidlanmassachusettspaki-bukaskatagaexperts,andoynilalangsayalupainpokerganyannababalotpakisabidiseasesinventadomaalwangexpedited