Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "fono"

1. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

4. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

5. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

6. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

Random Sentences

1. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

2. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

3. Naglipana ang mga turista sa baybayin ngayong tag-init.

4. El lienzo es la superficie más común utilizada para la pintura.

5. Pinagsama ko ang pulotgata at gata ng niyog upang gumawa ng matamis na meryenda.

6. All these years, I have been working to make a positive impact on the world.

7. The blades of scissors are typically made of stainless steel or other durable materials.

8. Comer una dieta equilibrada puede aumentar los niveles de energía y mejorar el estado de ánimo.

9. Wala na ang beyblade at ang may-ari nito.

10. Nakakalungkot isipin na wala na si Fr. Manoling Francisco, SJ, isa sa mga nagtatag ng Bukas Palad.

11. Gutom ka? kinagat ko ang labi ko at tumango sa tanong nya.

12. Sa dami ng nagnanais kumuha ng kursong iyon, mababa ang tiyansa niyang makapasok.

13.

14. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

15. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

16. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

17. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

18. Natutuwa ako sa balitang iyan mahal ko.

19. Tantanan mo ako sa legend legend na yan! hahaha!

20. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

21. Nauna na palang kausapin ni Cupid si Apollo kaya naman siya ang itinakdang mapangasawa ni Pysche.

22. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

23. Last full show tayo. Ano bang pinakamalapit na mall?

24. The bookshelf was filled with hefty tomes on a wide range of subjects.

25. Kapitbahay ni Armael si Juang malilimutin.

26. They are attending a meeting.

27. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

28. When we forgive, we open ourselves up to the possibility of reconciliation and rebuilding damaged relationships.

29. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

30. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

31. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

32. Despite the many advancements in television technology, there are also concerns about the effects of television on society

33. Kucing di Indonesia sering dimanjakan dengan mainan seperti bola karet atau mainan berbentuk tikus.

34. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

35. Kailangan mo ng matapang na puso upang lumaban sa agaw-buhay na mundo ng negosyo.

36. The United States has a complex political system, with multiple levels of government and political parties.

37. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

38. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

39. The children eagerly lined up for their share of the birthday cake.

40. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

41. I've been using this new software, and so far so good.

42. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

43. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

44. Opo. Magkapareho po ba ang disenyo?

45. Sa tuktok ng puno, natatanaw ko ang malawak na sakop ng kagubatan.

46. La tos puede ser un síntoma de COVID-19.

47. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

48. Sa mga siyudad, mahalaga rin ang mga punong-kahoy dahil nakakatulong ito sa pagpapalinis ng hangin.

49. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

50. She is not drawing a picture at this moment.

Similar Words

fonos

Recent Searches

fonodumagundongmakatarungangnagsagawanakasandigmakipag-barkadanagsunurannanlilisikkagandahankaibiganhumalomagtagoyumuyukokinalakihanninanaisbalahiboistasyondegreestaosnakapagproposepeksmansasakaymagamotpakikipaglabantumalonhastalansangantelecomunicacionesmilyongnalugodtumapospinangalanannapansinkaliwapisarahinagismakalinggagamitdalandancaracterizakinakainpalasyopatawaringarbansosmakapalhawlamagtipidcarbonpuwedevetotamakuyacompositorescolorkasaysayanbutomapaibabawcitizengraphicbinilhanmansanasreguleringcombinedlandparkingfeltlawssalarosawalngpangingimikaineducativassuccessfulupolaylaybook:majorbuwalcryptocurrency:shortfireworksbarnesbilinulamdelblesstelevisedarmedsharedollarstageenforcingexpectationsdidinghatethreehelpincreaseandyprotestainformedfluidityvisualtabaedittypesanynanggigimalmalsalbahepinuntahanmakapalagkumaliwanakikiaoutpostsuelonatuyoipinabalikinterestyesmatangitakpinagtagponagbabakasyonmakapangyarihanmagpa-ospitalpinagmamalakilunasisinarabagamatvitaminkapwanasunogpigilanthirdnakikini-kinitasponsorships,ahhtumatawadtelebisyonnagsilapittenniskakilalapakukuluansanggolcomosquatterdebatesmind:beginningconnectiontaasagesmerlindaanibersaryonagpapasasamagpa-checkupmagkakaanakkinauupuanpagkahapopagtatanongtatawagmakikipagbabagtinaasanpresidenteairportpacienciahitaexhaustionstrategiesperopaghaliksumusulatjuegosmakaraannagkasakitmaulinigannaturalejecutanhiyamedya-agwagettataasdreamvidenskabmabatongnakalockkuwentomakapagempakebowlhawaiibilibidpinipilitjeepneysubject,lungsodlumusobmahalawitinasahan