Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "fono"

1. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

4. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

5. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

6. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

Random Sentences

1. Ang pagiging maramot ay hindi maganda lalo na kung may nangangailangan.

2. She is not playing with her pet dog at the moment.

3. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

4. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

5. Nang simula ay hindi napuputol ang komunikasyon ng magkasintahan, araw araw na sumusulat ang binata sa dalaga at ganoon din naman ang dalaga.

6. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

7. Today, Amazon is one of the world's largest online retailers.

8. However, there are also concerns about the impact of technology on society

9. Natawa na lang ako, Oo nga pala, ano nga ulit tanong mo?

10. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

11. The store offers a store credit for returns instead of a cash refund.

12. Don't count your chickens before they hatch

13. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

14. Alangan ako?! Ako na nga unang nagbigay eh! Ikaw naman!

15. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

16. She writes stories in her notebook.

17. Proper training and socialization are essential for a well-behaved dog.

18. Lahat sila ay angkan ng matatalino.

19. Forgiveness allows us to let go of the pain and move forward with our lives.

20. Nakarating na kami sa aming pupuntahan.

21. Sa bukirin, naglipana ang mga tanim ng mais.

22. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

23. Saan naman? Sa sine o DVD na lang? tanong ko.

24. She burned bridges with her friends by spreading gossip about them.

25. Joshua, kumusta ang pakiramdam mo?

26. Tumingin muna si Tarcila sa asawa at...

27. Ang mabuting anak, nagpapalakas ng magulang.

28. Ang laki ng bahay nila Michael.

29. The United States has a system of federalism, where power is divided between the national government and the individual states

30. Ilalagay ko 'to sa mga action figure na collections ko.

31. Bukas ay mamamanhikan na kami sa inyo.

32. Ang pagpapabaya sa mga ebidensya at katotohanan ay nagdudulot ng pagkaligaw sa landas ng katarungan.

33. Scientific evidence suggests that global temperatures are rising due to human activity.

34. Madami ang nawalan ng trabaho dahil sa pandemya.

35. Kumakanta kasama ang Filipino Choir.

36.

37. La persona ebria en la calle está llamando la atención de los transeúntes.

38. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

39. Some limitations can be temporary, while others may be permanent.

40. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

41. Makakarinig ka ng halinghing sa gym, lalo na kapag may nagta-training ng cardio.

42. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

43. All these years, I have been learning to appreciate the present moment and not take life for granted.

44. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

45. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

46. Elektroniske apparater kan gøre vores liv nemmere og mere effektivt.

47. Sa aking probinsya, tawag sa pulotgata ay "latik".

48. Maaari po bang makahingi ng sobra sa hapunan ninyo?

49. The elderly are at a higher risk of developing pneumonia.

50. La paciencia es una cualidad que se debe cultivar.

Similar Words

fonos

Recent Searches

ginisingfonobokchadnamanagkitanakaupomagbagong-anyomagpa-picturenatulalamunangcomfortsalitangpinakamatapatkalakihanbangladeshpinagpatuloypagpapakilalanakapapasongnalulungkotpangkatfurtherteknologihospitalkasingsasamahanpagdukwangnakikianangangaralbiologidadalawinpamahalaanhumahangosanioperahanmaskarabloggers,pagtataposlumiwagpagkapitaskapangyarihangpamanhikannamamsyalnapakahusaypisingomelettetayoconcerntumunogmakikitulogmasasayangumiwipakakatandaanpinapatapospinakidalasariliscientificdadalhinnapakamisteryosopagtinginpalancamananakawkatuwaanpagkatakotmaipagmamalakingh-hoykabuntisansasakaynapatigilhanapbuhaybwahahahahahaintindihinmangahasmagalangkomedorkumanancompaniesiniuwihigantee-booksmahirapmagamottinungosumusulatumagatilipinilitkayorecibirsisentatataaspeppykatagalanbundoksinakopkaragatanganuno-orderkamatisbilhinbilineventsulamahitsellhangaringsuffercapacidadsiguroairconsumuotbansangpatakbofarmlegacykalahatingsagapkuyaklasengpatuyopitohappierpangingimiiiklimakaratingprutasmapahamakbinatangbehindarmedtaledaigdigmetodesedentaryhelpfulipinagbilingexpandedandybroadcastsanothermainstreamnicerelievedsafekeepinglalargamagingechavepisoentermalawakpilingbakunapag-asareviseuminompasyentejoymasukolmemorytinangkakahapontiplinggongkulungannakikitangnagdiretsosakupinbihirangpapalapitpapuntangcombatirlas,trentacultureshagdanantog,haponmaglaromakapalgospellunesbumuhosdiseasesentertainmentbanghinintayalmacenartaga-suportamay-arinagsilapitnegativeaksiyonubofuelandrelumbayinvolvehellocommerceitlog