Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "fono"

1. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

4. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

5. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

6. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

Random Sentences

1. Hindi ako makapaniwala na datapapwat ay nangyari ang ganitong kaguluhan sa aming lugar.

2. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

3. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

4. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

5. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

6. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

7. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

8. May I know your name for networking purposes?

9. No pain, no gain

10. Kantahan mo si Noel ng Kumanta ka ng kundiman

11. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

12. Naka color green ako na damit tapos naka shades.

13. Internal Audit po. simpleng sagot ko.

14. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

15. Piece of cake

16. Malapit na ang pyesta sa amin.

17. Ang aking teacher ay hindi muna nagturo ngayong araw.

18. Nakangiting tumango ako sa kanya.

19. Leonardo da Vinci trabajó para los Médici en Florencia.

20. She has written five books.

21. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

22. Athena.. gising na. Uuwi na tayo maya maya.

23. Naiinitan talaga ako, malamig ba labi mo?

24. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

25. Mahalaga ang pag-aaral ng talambuhay ni Marcelo H. del Pilar upang maunawaan ang kanyang papel sa kasaysayan ng Pilipinas.

26. Sa pagguhit, mahalaga ang tamang pagkakabalangkas ng mga elemento.

27. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

28. I forgot your birthday, but here's a card anyway. Better late than never, right?

29. Mas malaki ang bangka, mas malaki ang huli.

30. Hindi dapat tayo sumuko sa agaw-buhay na laban sa kahirapan.

31. Nous allons visiter le Louvre demain.

32. Sa panahon ngayon, maraming taong nagfofocus sa kababawan ng kanilang buhay kaysa sa kabuluhan.

33. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

34. Los padres pueden prepararse para el nacimiento tomando clases de parto y leyendo sobre el proceso del parto.

35. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

36. Taga-Ochando, New Washington ako.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

38. En invierno, los días son más cortos y las noches son más largas.

39. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

40. Tila hindi niya gusto ang mga sinabi mo.

41. Maaaring magdulot ng stress at takot ang pagpunta sa dentista, ngunit mahalagang malampasan ito upang maiwasan ang malalang dental problem.

42. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

43. Illegal drug traffic across the border has been a major concern for law enforcement.

44. Siya ay maramot sa pagbibigay ng tulong kahit marami siyang pera.

45. Mahirap maging may agam-agam sa buhay dahil ito ay maaaring magdulot ng pagkabalisa.

46. Dapat kong bilhan ng regalo si Maria.

47. It's raining cats and dogs

48. Ang aming mga pangarap at layunin ay pinagsasama namin bilang magkabilang kabiyak.

49. Nag toothbrush na ako kanina.

50. Übung macht den Meister.

Similar Words

fonos

Recent Searches

fonoakomahirammamibruceoutpostmagturonaritoreservedmaestroipinabalikavailablebuwalmadalasleadingkontingkingdomkawayankastilakapatiditinaaspoliticalelectroniccandidateofteinspirehelpfulkasinggandabumabapresstuwidiniindatuluyanharmfulinantoktabasprivateimpactocommunicationsiikutanibinaonhumanaphigantehalalanginamitgagambamakingnutsfriendsandyalignsexamplemaratingpointdesign,recentventadahilanbabetaleconvey,himselfbinabacontentconsistclassespusacapablebuwenasbumalikboksingbestidatinapaynapalitangbecomesbasahinbaldengbagyongaksiyonwidelynapilingwalongprocesscomputerformsunahinsolidifybinilingumayoswindowpublisheddumaramitumayoedit:tumamajobsganitotulangthankstennistaingasundaespeechnagsibilisiyangnyosimpelpuwedepuedespasahemagsugalparangparaanpabalingatpancitpadabogpanamapanalopalakaolivianinongnilutonanaognagingmulinglumulusobmotionmaubosmanggamagawalumakilorenalinggolightslibinglaruankumitakumaenkulangkinayakamiaskikokalonglarawankailanjeromeisulatinyonguniversityifugaosonidohumayonovemberhojas,hilingguestsganyanflavioexperteffectechavediningdidingdependcedulacancerbumugaakongkanilabighanibubongbranchboxingbobotobinasabayangnangumbidanakakatabamagnakawpagiisipkitnakakunot-noongculpritobservation,tutungotigastinanggalnaguguluhangumalisabotsequeisarecordedentry:stillnagpanggapgenerabalalakadbatalanhumarap