Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "alapaap"

1. Ako'y lumilipad at nasa alapaap na.

Random Sentences

1. Itinago ni Luz ang libro sa aparador.

2. Good things come to those who wait.

3. I'm not impressed with his art. Paintings like that are a dime a dozen.

4. All these years, I have been cherishing the relationships and connections that matter most to me.

5. The athlete's hefty frame made them well-suited for their position on the team.

6. Anong klaseng kuwarto ang gusto niya?

7. We have been waiting for the train for an hour.

8. Sa kasalukuyang panahon ang bayabas, bukod sa ito ay kinakain o pagkapitas sa puno, ito rin ay ipinansasahog sa ating mga lutuin.

9. Madalas kami kumain sa labas.

10. Los ríos y lagos son fuentes importantes de agua dulce.

11. "Ang buhay ay parang gulong, minsan nasa taas, minsan nasa baba," ani ng matandang nagkukuwento.

12. Hindi dapat tayo magbulag-bulagan sa mga insidente ng abuso sa ating paligid.

13. Lagi na siyang tulala, hindi na siya halos nakakapasok sa paaralan at lagi lang siyang nasa simbaha't nagdarasal.

14. Anong nangyari sayo? Bakit hinde ka nagkakakain?

15. The credit card statement showed unauthorized charges, so I reported it to the bank.

16. Tumayo ako tapos tumayo rin si Carlo.

17. Ramdam na ang pagod at hingal sa kaniyang pagsasalita.

18. Pinaayos ng paaralan ang ilaw sa silid-aralan upang hindi na magkakaroon ng problema sa lighting.

19. La esperanza y los sueños son las llaves para la felicidad y la realización personal. (Hope and dreams are the keys to happiness and personal fulfillment.)

20. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

21. Susunduin ni Nena si Maria sa school.

22. Ang galing nyang mag bake ng cake!

23. All these years, I have been blessed with experiences that have shaped me into the person I am today.

24. Mathematics can be both challenging and rewarding to learn and apply.

25. El lienzo es la superficie más común utilizada para la pintura.

26. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

27. Facebook Marketplace is a platform where users can buy and sell items locally.

28. Seperti makan buah simalakama.

29. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

30. Mi amigo es un excelente cocinero y siempre me invita a cenar en su casa.

31. Pinakamatunog ang tawa ni Ogor.

32. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

33. The package's hefty weight required additional postage for shipping.

34. Les sciences sociales étudient le comportement humain et la société.

35. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

36. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

37. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

38. Los cuerpos de agua ofrecen un hábitat para una gran diversidad de especies acuáticas.

39. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

40. Ang produktong ito ay may mataas na kalidad, samakatuwid, marami ang bumibili nito.

41. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

42. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

43. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

44. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

45. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

46. If you think he'll agree to your proposal, you're barking up the wrong tree.

47. Langfredag ​​mindes Jesus 'korsfæstelse og død på korset.

48. Kinabukasan ay nawala si Bereti.

49. Ano ang ginugunita sa Thanksgiving Day?

50. Hindi ko na kayang itago ito - sana pwede ba kita ligawan?

Recent Searches

alapaapmedicinenailigtaspagkuwanmagdamaganlabinsiyamamericalalakipagkainisproductividadlalakadnapakalusogsumigawmedisinaemocionesnaantigpatakbongumokaypagongpinauwingitinatinagsinehansinomangyarikapintasangpaiduniversityinnovationinstitucionesitinulosdumilatsigurotenidobayaningalagavariedadasukalbahagyangjulietpromisebinawianfuncionarbatatinignansundaekinantarestaurantmataposbumigaytiningnanimagesmatarayhomefulfillingsoundyeynatuloglayawpangilhinabolpublicityarkilaracialyorkjuanmasipagflamencotondotawaparoroonacareerbalancesneapunsodiagnosespresyobingoanaysemillascelularesmalayangdinanaslookedvistalamidpagkaraadalandanpootreloklimatelangcommunitydinalawheheipatuloylingidpinatidhidingsabihingsnobgrupofinishedmapakalifattextohitbubonggandasumindireservationyesadvancedlimosprocesoformasgapmessageleadgoingtechnologiesworkingexplainpossiblehalikaincreasedgenerationslonggrabenalulungkotdepartmentmaglinismatuklapbabasahinhaltsinnagpapaigibmagtatakapitakatumulongkungmaayoswinspalaysigkinalalagyanroonhindefrescoipinamilihastafilmskuyabalitakuwartoinirapangranadakakayananmasasayanakakatandanagmistulangkulungankommunikerermeronbuwenascompaniesdiyanhiramhagdananginagawaipagbilitinataluntonsuriinuwakenergysobrabigyan11pmmariostatusdecisionscontentfollowing,malakasdagat-dagatanganapfacemaskiloilonapakasipagwristnakapamintanaiyonghigithaliphalikgulaydrinkcablenakakabangonbuong