Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "money"

1. A lot of money was donated to the charity, making a significant impact.

2. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

3. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

4. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

5. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

6. Budgeting, saving, and investing are important aspects of money management.

7. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

8. Don't waste your money on that souvenir, they're a dime a dozen in the market.

9. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

10. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

11. If you think he'll lend you money, you're barking up the wrong tree.

12. Keep in mind that making money online takes time, effort, and patience

13. Lending money to someone without collateral is a risky endeavor.

14. Many people work to earn money to support themselves and their families.

15. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

16. Money can be earned through various means, such as working, investing, and entrepreneurship.

17. Money can be saved and invested to achieve financial goals and build wealth.

18. Money can be used for both needs and wants, and balancing these priorities is important for financial success.

19. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

20. Money can take many forms, including cash, bank deposits, and digital currencies.

21. Money has value because people trust that it can be used to purchase goods and services.

22. Money is a medium of exchange used to buy and sell goods and services.

23. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

24. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

25. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

26. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

27. People can also borrow money through loans, credit cards, and other forms of debt.

28. Some people view money as a measure of success and achievement, while others prioritize other values.

29. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

30. The charity organized a series of fundraising events, raising money for a good cause.

31. The company lost a lot of money by cutting corners on product quality.

32. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

33. The concept of money has been around for thousands of years and has evolved over time.

34. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

35. The elephant in the room is that the company is losing money, and we need to come up with a solution.

36. The management of money is an important skill that can impact a person's financial well-being.

37. The pursuit of money can have both positive and negative effects on people's lives and relationships.

38. The rise of digital currencies and payment systems is changing the way people use and think about money.

39. The value of money can fluctuate over time due to factors such as inflation and changes in supply and demand.

40. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. Mathematics has a long history and has contributed to many important discoveries and inventions.

2. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

3. Ang carbon dioxide ay ina-absorve ng mga puno.

4. Eine hohe Inflation kann das Vertrauen der Menschen in die Wirtschaft und die Regierung verringern.

5. Magkita po tayo pagbisita ko riyan.

6. Ang tagtuyot ay nagdulot ng malawakang pagkamatay ng mga alagang hayop.

7. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

8. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

9. Agaw eksena ang babaeng himihiyaw sa palengke.

10. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

11. At sa sobrang gulat di ko napansin.

12. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

13. "You can't teach an old dog new tricks."

14. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

15. She enjoys drinking coffee in the morning.

16. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

17. Si Leah ay kapatid ni Lito.

18. El acceso al agua potable es un derecho humano fundamental.

19. Ang punong-kahoy ay nagbibigay ng sapat na lilim para sa mga nilalang na nabubuhay sa ilalim nito.

20. Natalo ang soccer team namin.

21. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

22. Dahil sa magigiting nating bayani, nakamit natin ang araw ng kalayaan.

23. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

24.

25. The moon shines brightly at night.

26. Ang pagsasayaw o pagsali sa isang grupo ay nakagagamot sa aking kaluluwa.

27. But in most cases, TV watching is a passive thing.

28. Ang kumbento ang madalas tambayan ni Father at Sister.

29. Magsi-skiing ako sa buwan ng Enero.

30. Nabasa mo ba ang email ko sayo?

31. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

32. ¿Me puedes explicar esto?

33. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

34. Umalis siya papuntang Cebu kahapon ng hapon.

35. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

36. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

37. Nakakalasing pala ang wine pag napasobra.

38. Beast. sabi ko pagkalapit sa kanya.

39. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

40. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

41. At være transkønnet kan være en svær og udfordrende rejse, da det kræver en dyb forståelse af ens identitet og en følelse af mod og autenticitet.

42. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

43. Gusto ko dumating doon ng umaga.

44. The photographer captured a series of images depicting the changing seasons.

45. Paparami iyon at pumapaligid sa kanya.

46. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

47. Nationalism is often associated with symbols such as flags, anthems, and monuments.

48. Gumising ka na. Mataas na ang araw.

49. Paglingon ko, nakita kong papalapit sakin si Lory.

50. Sino ang doktor ni Tita Beth?

Recent Searches

moneyiniangatoktubrebigongdyosaheartbreaknaglalabaibinalitangbuenaaffiliateshinessoundsumugodbitiwankablanlimitedrosacallerrevolutionizedfar-reachingerapgageffektivasimnagsusulatbarrocospecificnakasalubongfirstactorunankinissallowseditorevolvedhorsesidopaslitsariwahinihilingmakapasanakaangatapopinalutomagtigilnapaiyakmay-arikapatawaranincidencepigainprouddumaanboyfriendnapabayaanborgerelumibottomarsimpelmasayapartslendingnakapamintanabowknowscomplicatedgiyeramababatidpersonalhinipan-hipanmeronlumisanpaakyatnyomagagandamataaasbayaranngayonkatulongabonogriposakaycultivarcaraballoyangnakahigangalas-diyespabalingatmagdoorbellpinangalanangnalakifreelumilipadkakataposmag-isababasahinkumpletotanongabut-abottangeksbuwenashoneymoonoraspinabulaanparaangika-50sabongmusicalempresasdisensyosisikatkindergartenkassingulangpapuntangumikotikatlongnawalasantostumingalasamakatwidna-curioussilamamarilhikingambagoverallfionaritwalunangflaviomulighedmembersbritishcuentansamfundadicionalesaccederbipolarsnobsusunduinisaac1935nuonpangalanmahahaliktrippasangpinagwagihangchangepasokbitbitconsidersinabingsummitmakaratingleftnasasakupanbakeexhausteddiwatamagkasakitnaiinisikinabitrelyminerviehinahaplospagkagising1954paldalegitimate,bangkapeksmanmournedipinangangakaking1000examplesayosaan-saanmemorialpamilihansakinipipilitjerrybinibiyayaanexhaustiongrewpaalamiglapspaghettiipinanganakrawwatchmaipantawid-gutombecamedalawinedsadissesumuotparingmagnify