Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "back"

1. A couple of photographs on the wall brought back memories of my childhood.

2. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

3. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

4. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

5. Me duele la espalda. (My back hurts.)

6. Revise and edit: After you have a complete draft, it's important to go back and revise your work

7. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

8. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

9. Television has a long history, with the first television broadcasts dating back to the 1920s

10. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

11. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

12. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

13. The store was closed, and therefore we had to come back later.

14. The website is currently down for maintenance, but it will be back up soon.

Random Sentences

1. This has led to increased trade and commerce, as well as greater mobility for individuals

2. Kung may gusot, may lulutang na buhok.

3. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

4. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng kasiyahan at kaganapan sa aking buhay.

5. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

6. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

7. Knowledge is power.

8. Gusto mo ba ng isa pang tasa ng kape?

9. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

10. Kung papansinin mo'y lagi ka ngang mababasag-ulo.

11. Napapatungo na laamang siya.

12. Hun har en fortryllende udstråling. (She has an enchanting aura.)

13. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

14. Ok lang ba to? Baka naman magalit si Abi.

15. Napakabagal ng internet sa aming lugar.

16. Itinaas niya ang tirante ng kamiseta.

17. Lumiit ito at nagkaroon ng mga mahahabang paa.

18. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

19. The United States has a system of government based on the principles of democracy and constitutionalism.

20. Ano ang sasabihin mo sa kanya?

21. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

22. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

23. Murang-mura ang kamatis ngayon.

24. The telephone has undergone many changes and improvements since its invention

25. Magaling sa pagguhit ang kuya ko.

26. My mom always bakes me a cake for my birthday.

27. My grandfather used to tell me to "break a leg" before every soccer game I played.

28. Emphasis is often used in advertising and marketing to draw attention to products or services.

29. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

30. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

31. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

32. Hinanap niya si Pinang.

33. Like a diamond in the sky.

34. He makes his own coffee in the morning.

35. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

36. Sumakay kami ng kotse at nagpunta ng mall.

37. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

38. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

39. Ang mga pook na mayabong na mga bulaklak ay karaniwang pinupuntahan ng mga turista.

40. The company's CEO announced plans to acquire more assets in the coming years.

41. "Laging maging handa sa anumang sakuna," ani ng opisyal ng gobyerno.

42. Saya suka musik. - I like music.

43. Ang kabayanihan ni Rizal ay patuloy na pinararangalan sa pamamagitan ng pagdiriwang ng kanyang kaarawan at mga aktibidad sa buong bansa.

44. El que espera, desespera.

45. Habang nglalaba si Aling Rosa at iba pang may-bahay ay masayang nalalaro at naliligo ang mga bata.

46. Ang pagbisita sa isang silid-pahinga o spa ay nagbibigay sa akin ng isang matiwasay na karanasan ng kalinisan at kaginhawaan.

47. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

48. The bride looked stunning in her wedding dress, truly a beautiful lady.

49. Nagkakasayahan sila sa isang panig ng bilangguan

50. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

Similar Words

backpackfeedbackfeedback,

Recent Searches

backbilingalignsnutstechnologycorrectingnariningflydarkhimselfmichaelmagtatagalspiritualpinagsikapanpinakamaartengpagluluksapumapaligidrevolutioneretmagpagalingpamilyangkapatawaranmagbibiyahenagpipikniknagtatampokinikitakagandahagenviarjingjingnapuyatnagdabogkanginanangyarikaklaseyouthnaiilangtumirakamiasarbularyocover,sinolungsodeksempelkampeonpagguhitpumulotnanonoodhouseholdnatabunanpicturesminervieguerreroinhalekarapatangtienenpakistanika-50bilibidmagselosanumangkainitanempresasginaganoonalaycarbontuvoriyanbigongmariaskyldesathenasandalitssssumisilipstatemahabakambingimbespaldapalapagbarangaynababalotnapasukonilalanghinukayduwendemaghatinggabisementobecomingpeaceneamayroonpangingimiganadiagnosesmrstiketdipangpanosemillasneed,aniyaiilanzoohuwebeswashingtonfilmsmalihiscoalilocosdumaanninongdibacreatingbinulonglimosnuonconectadosdagatonsumusunodinalawseeilogmanuscriptmaluwangclientsamparolulusogkumaripasaudio-visuallymuchascafeteriabotebinabalikasinfreelanceripagamotwordsleukemiaamongnamumulaklakutilizalamigfrogdatitilapagawainpagsilbihanpabalingatsignopomaluwaggeneratelcdpaslitnaroonbarnucleartuwidinalisinalokthesemalabostrategylineirogmahiwagangmagsusunuransimulanagwo-workpanatagintramurosneedmartialmoreikinagagalakpaki-translatesidonakabaonkasamaansundalojejumadamibinawilayuanlalongjancornersburgerbinatilyomaalwanglenguajemagpuntaestarpinyanag-aaralkusinabarongnagliliyabisinulat