Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "back"

1. A couple of photographs on the wall brought back memories of my childhood.

2. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

3. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

4. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

5. Me duele la espalda. (My back hurts.)

6. Revise and edit: After you have a complete draft, it's important to go back and revise your work

7. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

8. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

9. Television has a long history, with the first television broadcasts dating back to the 1920s

10. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

11. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

12. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

13. The store was closed, and therefore we had to come back later.

14. The website is currently down for maintenance, but it will be back up soon.

Random Sentences

1. Wag mong ibaba ang iyong facemask.

2. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

3. Women have made significant strides in breaking through glass ceilings in various industries and professions.

4. Walang nakakaalam kung saan sila napupunta.

5. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

6. He is taking a walk in the park.

7. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

8. Dapat akong bumili ng regalo para kay Maria.

9. They have been studying for their exams for a week.

10. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

11. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

12. Huwag mo nang papansinin.

13. I know we're behind schedule, but let's not cut corners on safety.

14. Nakaupo ako nang matagal sa sinehan.

15. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

16. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

17. Kailangan kong tapusin ang ginagawa ko.

18. There's no place like home.

19. Sinong may sabi? hamon niya sa akin.

20. Limitations can be a result of societal or systemic inequalities and discrimination.

21. At naroon na naman marahil si Ogor.

22. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

23. Nakagagamot ng diyabetis ang halamang ito.

24. Ang matandang babae ay pinagpalaluan ng buong barangay dahil sa kanyang karunungan at malasakit.

25. Humahaba rin ang kaniyang buhok.

26. Anong ginagawa mo? nagtatakang tanong ko.

27.

28. Anong oras sila umalis sa Camp Crame?

29. La science est la clé de nombreuses découvertes et avancées technologiques.

30. I need to check my credit report to ensure there are no errors.

31. Kings may wield absolute or constitutional power depending on their country's system of government.

32. Sa pulong ng mga mag-aaral, ipinahayag nila ang kanilang mga mungkahi upang mapabuti ang pasilidad ng paaralan.

33. I'm not going to pay extra for a brand name when generic options are a dime a dozen.

34. I have started a new hobby.

35. The telephone has undergone many changes and improvements since its invention

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. Kinakailangan niyang magpakatatag kahit na nag-iisa siya sa laban.

38. Salbahe ang pusa niya kung minsan.

39. Bawat galaw mo tinitignan nila.

40. Diving into unknown waters is a risky activity that should be avoided.

41. Sa muling pagkikita!

42. Lumingon ako para harapin si Kenji.

43. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

44. Napakarami niyang natutunan sa workshop, samakatuwid, handa na siyang gamitin ito sa trabaho.

45. Matagal-tagal na siyang tulala, hindi niya alam kung ano ang gagawin.

46. Teknologi er en vidtstrakt kategori, der dækker over en række forskellige områder, fra elektronik til software til maskiner og transportmidler

47. Kumunot lang ang noo ko, That's not my name.

48. Me duele al tragar. (It hurts when I swallow.)

49. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

50. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

Similar Words

backpackfeedbackfeedback,

Recent Searches

statingwebsitebeyondheftycreatingbackmerestreamingnakakapagpatibaypagkakayakapkaaya-ayangngingisi-ngisingkasalukuyanenfermedades,kadalagahangnag-aalangannamumuongopportunitybumalikmagbayadpumapaligidinilalabastreatsnahuhumalinglumiwagkagandahanpamahalaanlumiwanagnagpapakainkinapanayammagbibiyahekalakihannakalilipasmasaksihanpaghaharutanmontrealnaapektuhantanggalinmagdoorbellnapipilitanfilipinakalaunannakangisiuusapankare-karepamilihanpaanongparehongnapasubsoblumilipadpumilihumaloilalagaykinalilibinganmagbibiladabut-abotkondisyonpinapataposhoneymoonkwartogovernmentnagsuotumuwihandaangawaingnationalbakanteempresasbasketbolpundidokapitbahaymabagalfranciscomusicaleskahongmaghahabinaaksidentepinangalanangnasagutantinahakgathermaramilangitmababawhinagismataaaspagpasokkuboturonpalapagteachingskaninaipinambilicaraballomaghatinggabiebidensyanapapneumoniarequierenumabotmaranasaneksport,gusalisabongmakausapde-lataumiwassaktanmagalitsteamshipsgarbansoskailanmanpalasyodurantepapayanawalalumilingonnoonmatulishigh-definitionknightwatertamaanihinreviewkuwebamaistorboheartbreakbinanggaparehashoymaliitchumochosmimosabotebabeskotsengcollectionsboboconectadospostcardchoiceuncheckedsaanstillbuwanilangsenatewordconsistfiabecomenanghuhuliseguridadsantogivebiluganghojaswarigrammarsigalintacomunicanindustrymagtipidconsumeadoptedbestpalaytitigillaylaydahonluispupuntapalagingsciencekumaripaspetsaoncedesdechangelorilabanlabingbuwalseparationanumangapomotionevendigitalanimviewsmichaelmarkedtrainingschoolfatalgenerateboses