Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "conectados"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

2. Nang siya'y mapaibabaw, sinunud-ssunod niya: dagok, dagok, dagok.

3. TikTok has inspired a new wave of viral challenges, from dance routines to lip-syncing.

4. Con paciencia y perseverancia todo se logra.

5. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

6. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

7. Football is a popular sport for both men and women, with many professional women's leagues around the world.

8. Limitations can be financial, such as a lack of resources to pursue education or travel.

9. Ano ang ginagawa niya sa gabi?)

10. Kahit hindi ako nagpapakita ng kilos, crush kita pa rin sa loob ng puso ko.

11. Ang batang matuto, sana sa matanda nagmula.

12. Fødslen kan tage lang tid, og det er vigtigt at have tålmodighed og støtte.

13. Claro que puedo acompañarte al concierto, me encantaría.

14. Hindi ba nagdaramdam ang nanay at tatay mo?

15. He was warned not to burn bridges with his current company before accepting a new job offer.

16. Tengo dolor de articulaciones. (I have joint pain.)

17. The Colosseum in Rome is a remarkable wonder of ancient Roman architecture.

18. Tignan nyo. ngumingisi! May balak yan! Psh.

19. Matagal na yan. Hinde ko lang nabigay sayo.

20. Buenos días amiga

21. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

22. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

23. Proper training and socialization are essential for a well-behaved dog.

24. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

25. Kailangan mong bumili ng gamot.

26. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

27. Matagumpay akong nakapag-alaga ng mga halaman kaya masayang-masaya ako ngayon.

28. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

29. The President is elected every four years through a process known as the presidential election

30. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

31. ¿Cual es tu pasatiempo?

32. Ngayon lang ako nag mahal ng ganito.

33. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

34. Umalis na siya kasi ang tagal mo.

35. Einstein was also an accomplished musician and played the violin throughout his life.

36. ¿De dónde eres?

37. Nagbabaga ang hangarin ng mga kabataan na magtagumpay sa kabila ng mga hamon.

38. I've been taking care of my health, and so far so good.

39. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

40. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

41. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

42. He has been practicing yoga for years.

43. Viruses are small, infectious agents that can infect cells and cause diseases.

44. Nakikisalo siya sa pamilya at totoong nasisiyahan siya.

45. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

46. Kapag dapit-hapon, masarap magpahinga sa parang habang nakatingin sa mga bituin.

47. Stocks and bonds are generally more liquid than real estate or other alternative investments.

48. Napuyat na ako kakaantay sa yo.

49. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

50. Hindi ah? tinaasan ko sya ng kilay.

Recent Searches

conectadosnakakaenmaghahatidbarpaslitratecommercebalethoughtsannadooncorrectingexitinsteadhighestablepointandywalngnawalannetoamountpangingimisatineffektivtlawaylolapangkatnapakahusayoccidentaluntimelyokaybangpeppyeducationinangatnagsagawaphilippinenewskumunotumagangisinulatsesamefilmsilalimkaragatan,pagpapasakitnaalalakindergartenescuelasblusangkamatisasulctilesoncealitaptapganunkalikasantipidmuchanagtagalpagdukwangmasayahinbossmaglumakasgranadakalabantinanongelectionsnaghihirapbanggainmagsi-skiingsiyang-siyadagat-dagatannagpapakinisusayumaonagtagpopingganeducatingalanganrequierenfacultyahassumalakaykasawiang-paladtaon-taonisinagotafterincludeanthonyantokguiltyganoonbipolarcarloyunbuhokbilangindreamslasamaya-mayaexpandedmagulayawnagreklamominamahalnakadapananghingimakingpagkahapopagsumamohospitalmagasawangtwo-partynagpipiknikpaglalayagespecializadasnapakahangapunung-punogayundinnangingisaycaracterizapinangalananmakaiponnamumulaibinaondesarrollarkamandagkaninokakainininilistanandiyanexcitedngipinghuertogloriaalaalapatunayanmariamayamanlandzamboangaibinentamanghulibangkodefinitivoakmapilipinasanywheretienenganaiwasiwassuccessinomredigeringmustlarolalainiintaydreamabrilorderinbarolinggo1929pinagtagpoparagraphsminutomagpuntadeterioratepiecesnaghinaladolyarlarrytalenteddurijokefurybulakalakdependingformatbilingpublishedpinilingservicesbumabamagpalagokumbentowhateverkatierisknakainomkampanasuhestiyondadtommasilipstrategybride