Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "conectados"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

2. El internet es una fuente de entretenimiento, como videos, juegos y música.

3. Have you been to the new restaurant in town?

4. Mahusay talaga gumawa ng pelikula ang mga korean.

5. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

6. The game is played with two teams of five players each.

7. Dahil ika-50 anibersaryo nila.

8. Sarado ang eskuwela sa Sabado at Linggo.

9. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

10. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

11. The sun does not rise in the west.

12. Este plato tiene un toque picante que lo hace especial.

13. Ako si Rodona ang diwata ng budok na ito.

14. He plays chess with his friends.

15. Ano ang mga apelyido ng mga lola mo?

16. La realidad es que necesitamos trabajar juntos para resolver el problema.

17. Sa kanyang pag-aaral ng sining, pinagmamasdan niya ang mga obra ng mga kilalang pintor.

18. Halatang takot na takot na sya.

19. Las hojas de otoño son muy bonitas en la ciudad.

20. Lucas.. sa tingin ko kelangan na niyang malaman yung totoo..

21. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

22. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

23. One of the most significant areas of technological advancement in recent years has been in the field of communications

24. Pagkatapos kong ipagbili ito, bibili ako ng pagkain natin.

25. They offer interest-free credit for the first six months.

26. Nagtawanan kaming lahat sa hinirit ni Kenji.

27. Las labradoras son conocidas por su energía y su amor por el agua.

28. Gusto ko sanang makabili ng bahay.

29. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

30. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

31. Sa gitna ng kalsada, napansin ko ang isang maliit na bata na napapalibutan ng matinding pagdidilim.

32. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

33. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

34. You can't judge a book by its cover.

35. Nakakamangha naman ang mga tanawin sa lugar nyo Edwin.

36. The patient had a history of pneumonia and needed to be monitored closely.

37. Since wala na kaming naririnig medyo kumalma na ako.

38. A veces tengo miedo de tomar decisiones, pero al final siempre recuerdo "que sera, sera."

39. Ang pagmamalabis sa pagkain ng matataba at malasa ay maaaring magdulot ng problema sa kalusugan.

40. Protecting the environment involves preserving natural resources and reducing waste.

41. Nag-alala ako nang magdidilim na ang paningin ko habang nagmamaneho sa isang maulang gabi.

42. Mababa ang kalidad ng produkto kaya hindi ito nagtagal sa merkado.

43. Ang boksing ay isa mga sa sports na kinahuhumalingan ng mga Pilipino.

44.

45. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

46. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

47. Baka matunaw ako. biglang sabi niya. Langya gising pala!

48. Ang salarin ay nagtago sa malalayong lugar upang makaiwas sa pag-aresto.

49. Hindi dapat natin tolerahan ang anumang uri ng paglapastangan dahil ito ay sumisira sa mga pundasyon ng pagkakaisa at paggalang sa isa't isa.

50. Ano ang nasa tapat ng ospital?

Recent Searches

conectadosintsik-behomayokumainearlysettingredestahimiklabaspakpakhelpfulnakihalubilonaiilanggitnapaungolhighcrushbadingfurtherinfinitykumaripasrawgenerabaenvironmentinternalthensampungkitconsiderarspansonlydiyaryosurveysbosesnahahalinhanadvancesbagoniyadadnaminpag-aralinbritishnaglipanangmagpasalamatkailantelangmagnanakawkuligligmananalopigilankaraokesinimulanoperatepulubiplatformtuwangkapangyarihanninumanutilizanwasaknagsagawanagpapakinismicanapatulalakatolisismoaniyapaglayasnakapuntangisilandaspusoothers,jobkonsentrasyonespanyolcinekabarkadafremstilleanitkawili-wilinasapaggawautak-biyakatapatnagulatdalawatrajepatiencemeanstiemposmayabongpetroleumeclipxenahihilohydelpaglalayagtresanimalumbaypasyalannag-replynapapasayalumilingonapoydayspaksakilalang-kilalaninonginteligenteskayapaglapastanganwastenerissapamamasyalpasensyaalas-diyesipinansasahogdiyankesonakaakyatyoutube,maongnakakagalapumuntakahoykasuutanpagsumamomagkamaliyumabongmagkakaroonhalikpaidpagkatakotkumidlatmaasahansections,kaalamantinapaymangyariintramurosinagawkumustanaglalakadsalbahengeithernagdaramdamuulitbayananilaganunfueldasalitinaasagam-agamngipingitodinnatitirangpiecespinilittaonmalayangpopularizepagbigyanmaputulanmisyunerongnandyanmatalimpakealamanmakapanglamangpaghihingalomabaitsantomagpapabunotlubosniyongumagamitika-12ikawtalinolamang-lupalamigutilizacoughingtumatakbofidelmovingmaghugasnapadpadpresencemumuntingtumikimburmahubad-barokutodpalapitmatutongmassesgranadarevolucionado