Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "conectados"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

2. Marami silang pananim.

3. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

4. He has improved his English skills.

5. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

6. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

7. Hindi ninyo madadala sa hukay ang yaman ninyo.

8. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

9. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

10. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

11. "The better I get to know men, the more I find myself loving dogs."

12. Saan pumunta si Trina sa Abril?

13. The feeling of finishing a challenging book can be euphoric and satisfying.

14. They are shopping at the mall.

15. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

16. Ang mga salaysay tungkol sa buhay at mga gawain ni Rizal ay naging paksa ng mga akademikong pag-aaral at pagsasaliksik.

17. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

18. Araw-araw ay ganoon nga ang ginawa ng tusong si Paniki.

19. Hinanap nila ang magandang babae upang pasalamatan ngunit wala na ito.

20. Wasak ang kanyang kamiseta at duguan ang kanyang likod.

21. Have we completed the project on time?

22. Lazada has a strong focus on customer service and has won awards for its efforts.

23. La paciencia es clave para alcanzar el éxito.

24. If you think he'll agree to your proposal, you're barking up the wrong tree.

25. Imbes na gamitin ang pana para kay Psyche, ay pinabayaan niya lamang itong mamuhay ng normal at tumaliwas sa utos ng ina.

26. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

27. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

28. Det er vigtigt at huske heltenes bedrifter og lære af dem.

29. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

30. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

31. Nakakuha ako ng sagot sa brainly.

32. It was founded in 2012 by Rocket Internet.

33. Ang haba na ng buhok mo!

34. Hindi sila makaangal sa di makatarungang pagpapautang.

35. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

36. Tanghali na nang siya ay umuwi.

37. Ano-ano ang mga sangkap ng iyong spaghetti?

38. The United States is the third-largest country in the world by land area and the third most populous country in the world.

39. She opted for a lightweight jacket to wear during her morning run.

40. The market is currently facing economic uncertainty due to the pandemic.

41. Bakit ho, saan ninyo ko dadalhin?

42. Pagkatapos pumili ng lugar, dapat mong magsimula sa pamamagitan ng pagpapakalat ng compost o fertilizer sa lupa bago magsimula sa pagtatanim

43. At ako'y namulat sa hubad na katotohanan.

44. Scissors are an essential tool in classrooms for art projects and cutting paper.

45. Mahabang pangungusap ang isinulat ni Lito sa pisara.

46. Bakit ka nasa hospital?! Sorry kanina.

47. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

48. Limitations can be physical, mental, emotional, financial, or social.

49. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

50. Ang mga palaisipan ay maaaring nagbibigay ng mga oportunidad para sa paglutas ng mga problema at pagtugon sa mga hamon sa buhay.

Recent Searches

megetconectadosrabereaderswordpanayanisorryproblemaayudabilispingganfloorcommunicationsfindlaterdeleiconputiburoltooinfluentialsedentarycomunestuwidstrengthinternaworkingflyventalockdownexitsusunodkasingcallingstyrerryanmenuanubayanpag-aaraldecreasediikutankainmartesagilitywaribobopagsigawitinatapattahanankailangannapagodalituntuninbagkusnangingitngitkabighaantesrisetinikaudienceiiwasanpromotesundhedspleje,sayanatigilannag-iyakankomunikasyonnakakabangontiismatalinopanghihiyangiiwanclientespangyayaripamanflyvemaskinerhiwagabidiretsahangkumikiloshiskidkiranmemoryyumaopumapasokitinalagangaffiliateiloilonalalabingprivatevarietyo-onlineprimerosmaruruminaiiritangmagpakaramibumaligtadculturasvidenskabnoonggulangpangakomartialsisidlanninyofauxanywheretignanaanhinreducedseriousailmentshallbinabalikcollectionseksenaofferagoskawayanbadingsingeralinlargefirstprogrammingnagbiyayangayonmagsasamasumusunonag-iisipnagtakatuyongnakaririmarimkwelyoinagawkinumutannananaloibinalitangkongresomagpasalamatumingitearnlihimpopcornpanigdaratingnagtungosambitpare-parehoplantarkonsentrasyonsaranggolasompunongkahoymusicfitnessmedikalmahinogaplicacionesprimerhigitestadosmaawaingdescargargusaliopportunityginatatlonapakaadvancementagricultoresnakapangasawapinag-usapantuluyannagmamadalimumuraeskwelahannakapagusapcandidatenakatayokumbinsihinmagkakailajosefaunattendedhumiwalaypinakamahabamakalipasumakbaykinalalagyannangangakonakabibingingsensiblemagingnaaksidentenakatuontungkodmagdaraostungopabilitransport