Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "conectados"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Maraming uri ng mga punong-kahoy na maaaring gamitin sa paggawa ng mga gamit tulad ng upuan, mesa, at iba pa.

2. Durante las vacaciones de otoño, visitamos viñedos para la vendimia.

3. Isang bansang malaya ang Pilipinas.

4. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

5. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

6. We have been painting the room for hours.

7. They have donated to charity.

8. Women have been subject to violence and abuse, including domestic violence and sexual assault.

9. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

10. Tinanggal ko na yung maskara ko at kinausap sya.

11. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

12. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

13. Nakatitig siya sa tatlo pa niyang kapatid.

14. All these years, I have been cherishing the relationships and connections that matter most to me.

15. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

16. Magsusunuran nang manukso ang iba pang agwador.

17. Hindi ibibigay ng Panginoon sa iyo ang isang pagsubok kung hindi mo ito kaya, magtiwala at maniwala ka lang sa Kanya.

18. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

19. En México, el Día de los Enamorados se celebra con una fiesta tradicional llamada el Día del Cariño.

20. Sa dapit-hapon, masarap mag-meditate at mag-isip-isip sa mga bagay-bagay.

21. Ang droga ay isang mapanganib na sangkap na maaaring magdulot ng malubhang mga epekto sa kalusugan ng isang tao.

22. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

23. Nagpamasahe siya sa Island Spa.

24. Hindi ko gusto ang taong nagpaplastikan dahil wala naman itong kabuluhan.

25. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

26. The decision to release the product early was a risky but ultimately successful strategy.

27. Effective use of emphasis can enhance the power and impact of communication.

28. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

29. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

30. She donated a significant amount to a charitable organization for cancer research.

31. The cake was a hit at the party, and everyone asked for the recipe.

32. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

33. Love na love kita palagi.

34. La música es una parte importante de la

35. My mom always bakes me a cake for my birthday.

36. Ang saya saya niya ngayon, diba?

37. Ipinagmamalaki ko ang pagiging Pinoy dahil sa mayamang kasaysayan ng ating bansa.

38. Beauty. maya-maya eh sabi ni Maico.

39. Trenta pesos ang pamasahe mula dito

40. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

41. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

42. Ang takip-silim ay isa sa pinakamagandang panahon upang maglakad-lakad sa gabi.

43. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

44. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

45. Kikita nga kayo rito sa palengke!

46. My boyfriend took me out to dinner for my birthday.

47. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

48. All these years, I have been chasing my passions and following my heart.

49. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

50. They offer rewards and cashback programs for using their credit card.

Recent Searches

labormayowalisveryconectadossakinconnectingkatabingsanreservesbroadcastsuffermalapadwaymagta-taxipageantbagkusintelligencemessagesettinglearningclockenterbilingclassmatemediumumarawnamungasquatterslavecasesmalakingipapahingacrazystudieddarksonupworkbroadconsiderarexitaleroleipipilitellenpollutionnamerevolucionadomagtatagalkadalagahangginugunitanaglalatangmagta-trabahonakapamintananagtatrabahotatagaltiktok,householdscourtpronounnakatulogpagtatanongnamumutlakagandahanaanhinpaglalayagpagkakalutonakapapasongkaaya-ayangnagmungkahidayiyonbaku-bakongusadireksyonkolehiyosiyangtangeksmasamangkabarkadanananalolosscountryoffentligemaramidesarrollaronconditioningpasswordpagtawanakaririmarimdesigningtinahakpinamalagimuligtipagbilispillnapakaiiwanpeacemerrypumapasokumuwialinlakasuniversityairconfrescomatigaskumembut-kembotpirataawithdtvsumindimakinigsnobraymondmakikikainniyonneromisasino-sinozebrafoundpalayoaralpartenaglalambingcommander-in-chiefsaginglarawancryptocurrency:kongresomagpasalamatmagdidiskopistapopulationbiyasforskelbalik-tanawhearwestmagbabayadarmaelnagwo-workgawainculturalexcuseuulitinindependentlytanongkaharianpansoladverselypagpanawlawspansinhawakfigurepunongkahoylucynag-iisipwalongpangyayaringsigemagbasanamannagpuntablognabigyanestudioworkingmagbagong-anyotumalonmusicnasasaktanfarmag-aaralsinisimakitaligawanyumakapisapaglayashahahanaggalatulisanbalingkampeonnakapagsasakaymasaraprambutanquedecreasedexamplebahalaharapredanuayokoitay