Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "conectados"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Ate Annika! Gusto ko yung toy! Gusto ko yung toy!

2. Bumuga siya ng hangin saka tumingin saken.

3. Magandang-maganda ang pelikula.

4. The mission was labeled as risky, but the team decided to proceed.

5. The Taj Mahal in India is a magnificent wonder of architecture.

6. Halatang takot na takot na sya.

7. L'intelligence artificielle peut être utilisée pour détecter les fraudes financières et les menaces à la sécurité.

8. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

9. Crush kita simula pa noong nakita kita sa klase natin.

10. Tumayo siya tapos nagmadaling pumunta sa cr

11. Maaliwalas ang paligid sa bukid tuwing madaling araw

12. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

13. Naulinigan ng makapangyarihang Ada himutok ng Buto.

14. Sa wakas, nangahas siyang sundin ang kanyang pangarap, anuman ang mga balakid na nasa kanyang harapan.

15. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

16. Les régimes alimentaires restrictifs et les comportements alimentaires obsessionnels peuvent nuire à la santé mentale.

17. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

18. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

19. Alin ang telepono ng kaibigan mo?

20. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

21. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

22. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

23. Emphasis is an important tool in public speaking and effective communication.

24. Mayoritas penduduk Indonesia memeluk agama Islam, yang merupakan agama mayoritas di negara ini.

25. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

26. Magdamagan silang nagtrabaho sa call center.

27. Kebahagiaan adalah keadaan emosional yang diinginkan oleh setiap orang.

28.

29. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

30. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

31. Investors can purchase shares of stocks through a broker or online trading platform.

32. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

33. There are many different types of microscopes, including optical, electron, and confocal microscopes.

34. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

35. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

36. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

37. Auf Wiedersehen! - Goodbye!

38. Scientific research has shown that regular exercise can improve heart health.

39. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

40. I love you so much.

41. Lumungkot bigla yung mukha niya.

42. Nagliliyab ang kalangitan sa gabi dahil sa mga paputok.

43. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

44. Mahalaga na magtulungan tayo upang maabot ang ating mga pangarap bilang isang grupo o komunidad.

45. Tinanong niya ang mga kapitbahay kung nakita nila ang kanyang anak.

46. Emphasis can also be used to create a sense of urgency or importance.

47. Tumitigil lamang ito sa gabi upang makapagpahinga ang mga hayop upang sa susunod na araw ang may lakas sila upang ipatuloy ang pakikipaglaban.

48. Me duele el estómago. (My stomach hurts.)

49. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

50. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

Recent Searches

conectadoskapagtomnagdiriwangconcernsanimoylulusogtonpdaeksaytedmurangbroadcastkendiculturebubongnag-eehersisyomedyosteerakmaalispag-asakahirapanfindehavemagkaibiganleadersminsanproductividadbloggers,andrewpakakatandaanlikasgatolschoolhinabinaglabastorymaya-mayanginingisihanincidencekasakitkinumutanbinatilyobooksplagaskilalang-kilalaangkanoutlinedalagaarghlendingbecomesasamaisa-isakalayaandingjoymemorialpublishinginalokfourrightsipihitrelevantsorpresapagngiticultivatitahimpaghahabimakatuloggumawadelahvordanmasungite-commerce,nilalangmaingatsinungalingmahigit1929sisterdalawaharingbringtungawumikotniyonnangalaglagnasasalinankassingulangpitumponginspirationdesign,babaingvelfungerendetiyoadicionalesmakuhamatamantalagamakapagempakekasaysayansonidotvstupeloiiklimaaringdagacompostelareportermapunderholdercarlocebuanothernagpakitalasingnapakatagalnakapagreklamomagkaparehopagsasalitapupuntahankumpletopagkakamalimasayahinkinalakihankumikilospagtawaallowingmagagawaagadimporpinag-aaralanhelpedattorneyvaliosamanakbointerests,isinagotiligtasdepartmentnakauslingalagangbayangitsuraumigibrimasanihinbahagyaautomationtigasbinibiliinakyatpresleymariainvitationitongmaidlahatganasigealexandersigatanodailmentsitakfreelancerasinwordswidespreadcallertenderprosperreloproductioneffektivmayroonnaapektuhandaangellanakabanggagodipinabalikoutlinesbeintedemocraticbinabalikshockpalayancommunicationsgamessumangstonehamlaterstrategynuclearconsiderpapuntastudents