Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "streaming"

1. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

2. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

3. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

4. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

5. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

6. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

Random Sentences

1. Alt i alt er den danske økonomi kendt for sin høje grad af velstand og velfærd, og dette skyldes en kombination af markedsøkonomi og offentlig regulering, eksport, offentlig velfærd og økologisk bæredygtighed

2. Kumanan po kayo sa Masaya street.

3. Ehehe. Siya yung boyfriend ko.

4. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

5. Mila Romero ang pangalan ng tiya ko.

6. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

7. Oh masaya kana sa nangyari?

8. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

9. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

10. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

11. Durante su carrera, Miguel Ángel trabajó para varios papas y líderes políticos italianos.

12. The scientific community is constantly seeking to expand our understanding of the universe.

13. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

14. Me duele todo el cuerpo. (My whole body hurts.)

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. Algunos artistas famosos incluyen a Leonardo da Vinci, Pablo Picasso y Frida Kahlo.

17. Alam kong heartbeat yun, tingin mo sakin tangeks?

18. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

19. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

20. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

21. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

22. Maraming alituntunin ang ipinatutupad sa eskwelahan.

23. They have been creating art together for hours.

24. Ang pakikinig sa malumanay na himig ng mga instrumento ay nagpapalapit sa akin sa isang matiwasay na mundo.

25. Napahinto rin kami dahil kay Jenny.

26. Kapag may kailangang desisyunan, hindi maiiwasan na magkaroon ng agam-agam sa kung ano ang tamang hakbang.

27. Using the special pronoun Kita

28. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

29. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

30. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

31. Malalaki ang ahas na nakakulong sa zoo.

32. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

33. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

34. Ayos lang. Basta alam kong safe kang nakauwi.

35. Ang magnanakaw ay napag-alamang anak ng isang kilalang kriminal sa lugar.

36. Pneumonia can be life-threatening if not treated promptly.

37. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

38. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

39. Tumayo yung lalaki tapos nakita niya ako.

40. Si te gusta la comida picante, prueba el guacamole con jalapeño.

41. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

42. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

43. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

44. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

45. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

46. Inaamin ko rin na kulang ang aking nalalaman.

47. Wala ka naman palang pupuntahan eh, tara na lang umuwi na!

48. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

49. Pagkain ko katapat ng pera mo.

50. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

Recent Searches

streaminginfluencewatchbilisdemocraticmeet10thtools,previouslyvisanak-pawisfatalsalu-saloinfluentialheituwidtungkolnatalomuntinlupanagmumukhamaipagmamalakingobserverernagdudumalingpamburamaniwalakanikanilangerlindakasintahanpioneertagilirandisfrutarproductividadmaghahatidfactoresberegningerstorypalapagbayaningmaghatinggabitaposdiagnosticnatuloginuminfinished18thtilcallipapainitheftyallowedrobertkumembut-kembotgayunpamanmakingmagsugaltamarawmatandakayang-kayangnagtutulunganhinahangaannaghandangpagkakakulongmaipagpatuloymakangitihila-agawannaka-smirknapakagagandamakipag-barkadakaringmonsignoripinansasahogrewardinginiirognagsmiledamdamintanawinprobinsiyanaalishinagpisyakapinkahaponnalamantumalimnatutuwainilagayyoutubeannikaninaharapkapeayokooutlinespedrotechnologiescomienzanwealthkaninumannakuhamagagandanagaganapmusicalesbabasahinnag-emailpansitkinagatkailanmanjeepneymatagumpayoutlinenatayopiercanadapicsyeloincludeoverallgreatlyiwasankindergartenmamanhikandemocracydalawangresponsiblenatitirangmagkaibanutrientesnagpatuloyprusisyonnagmamadalioccidentalmakidaloquicklypagpapautangpandidiripopcornonline,nakitulogmusicnaantigmasanaygalaanisinalaysaynaghubadjagiyactricasbumabagarteeditnapatinginmaihaharapnagwelganamulaklakkaloobangnagtungonakumbinsimagkakailapaki-translatepresidentialmarketplacespare-parehoposporokinamumuhianmoviesnapakamisteryosonakangisiiintayingawinnapaiyakpinakamahabaluluwasmagbayadmaghahabimakahiramnanahimiknakakatandakamakailanteknologisallyinvesting:nakatapatmakapalagamericamarasiganmagpasalamatpaghuhugaso-onlinemagtigilpagkaraasabihinseryosongtig-bebeinterodonausuariodiyannanangisgospelmamahalinkommunikerersocietynakabilad