Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ito lang naman ang mga nakalagay sa listahan:

2. Napagod si Clara sa bakasyon niya.

3. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

4. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

5. Mayroon akong asawa at dalawang anak.

6. Les enseignants peuvent organiser des sorties scolaires pour enrichir les connaissances des élèves.

7. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

8. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

9. Sa aking balkonahe, natatanaw ko ang pagsikat ng araw sa silangan.

10. Napag desisyonan ko na. Love is sacrifice, right?

11. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

12. Ang talambuhay ni Apolinario Mabini ay nagpapakita ng kanyang talino at dedikasyon sa paglilingkod sa bayan.

13. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

14. Cryptocurrency has faced regulatory challenges in many countries.

15. Nagpatupad ang mga pulis ng checkpoint upang mahuli ang mga posibleng salarin.

16. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

17. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

18. En Argentina, el Día de San Valentín se celebra en el mes de julio.

19. Las heridas punzantes, como las causadas por clavos o agujas, pueden ser peligrosas debido al riesgo de infección.

20. At malaman ng maaga ang wasto sa kamalian.

21. Ang kwento sa pelikula ay ukol kay Aristotle na lumaban sa katiwalian.

22. Itinago ni Luz ang libro sa aparador.

23. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

24. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

25. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

26. Anong klaseng sinigang ang gusto mo?

27. Uuwi kami sa Pilipinas sa Disyembre.

28. Masaya ang pakanta-kantang si Maria.

29. Tak ada rotan, akar pun jadi.

30. She is cooking dinner for us.

31. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

32. Nakahug lang siya sa akin, I can feel him..

33. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

34. Los granjeros deben estar atentos al clima para saber cuándo es el mejor momento para cosechar.

35. It can be helpful to create an outline or a mind map to organize your thoughts

36. The momentum of the protest grew as more people joined the march.

37. In the early days, telephones were connected to a central switchboard, which connected calls manually

38. ¿Cuánto cuesta esto?

39. Masipag manghuli ng daga ang pusa ni Mary.

40. Nagulat ang magkasintahan nang biglang dumating ang pamilya ng lalaki para sa pamamamanhikan.

41. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

42. Ang laki ng pinanalunan nila sa lotto.

43. Selvstændige medarbejdere arbejder ofte på egen hånd.

44. They have been creating art together for hours.

45. Ako si Rodona ang diwata ng budok na ito.

46. Ang maliit na mesa ang nasa kuwarto.

47. Les programmes sociaux peuvent aider à réduire la pauvreté et l'inégalité.

48. Sa gitna ng galit at poot, nahihirapan akong makapagpatuloy sa aking buhay.

49. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

50. La pobreza es un problema que afecta a millones de personas en todo el mundo.

Similar Words

popularize

Recent Searches

masipagpopularsisidlankinsealamidtsehudyatlilimpanunuksoreplacedika-12paroyepjoshsantoreteklimaaalissumakitbinabalikheleitinagohalamanformaspracticadodrewalinanlabomahahawalargewritedulodeclarenagdabogpagkagisingmatapangpagluluksanagtatrabahomakikitanakabulagtangnagbanggaanginugunitagobernadornapakatagalikinagagalakpalipat-lipatpagkakatayomedya-agwapagka-diwatanaglalabastoryourcommunicationbusinessesparehongnakatulogteknologicrucialnagdiretsonakatapatpronounpagtangismagsi-skiingtungawatensyonpinagkakaabalahansinundangnamumutlapaghihingalomagpagalingsiniyasatmaalwangaanhinmiramanamis-namismakakatakasnagpalalimpinakabatangtulongkararatingnakabawipalaisipanpangangatawankahuluganmagsusuotmakabilinasiyahantatagalnaiilaganpublicationpanalanginstrategiesnangangakomagpapigilnaiisipdyipnio-onlinenalamankalabawyakapinnapalitangnailigtasmalulungkotvaccinesrenacentistanapansinuniversitycompaniespakinabanganmagamotmaabutanpaghangakolehiyomakapalinuulamnakangitinapatakbocosechasgiyerapapuntangbinge-watchingpinangaralannapiligawaintutusinsignalkisapmatamasaganangpaanopundidotilgangyunhinalungkatparusahankuligligdecreasedcrameginawangna-curiousguerreroisasamapwedengsilid-aralanbayadkinamumuhianpauwinakakapuntaobservation,grocerytraditionalbanalriegatalinoawitanroofstockunconstitutionalbumalikrolandcalidadalmacenarentertainmentnasuklampagkaingvelfungerendekumapitumagadealmaramotdalawangjackherramientamaingatboracaypangildeletingsusihikingtelefontinapaytigaspersonguidancepepeaniyaailmentsbilaowashingtonzookatagawasakhvergivernagpuntadibaipinadalasinunodgreatbabesisaacnoo