Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

2. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

3. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

4. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

5. The children are playing with their toys.

6. Masarap ang litson kaya lang nakakataba.

7. Los asmáticos a menudo experimentan tos como síntoma de un ataque de asma.

8. Kasama ang katipunan, Matapang na pinunit nina Andres Bonifacio ang cedula bilang protesta sa mga espanyol.

9. They are hiking in the mountains.

10. She enjoys taking photographs.

11. Sasagot na sana ako ng 'oo' ng...

12. Si Ana ay marunong mag-dribble ng bola nang mabilis.

13. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

14. Ate Annika naman eh, gusto ko ng toy!

15. Masaya ang pakanta-kantang si Maria.

16. Hindi sang ayon si Magda sa mga sinabi ni Mariel.

17. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

18. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

19. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

20. Hala, change partner na. Ang bilis naman.

21. Yey! Thank you Jacky! The best ka talaga!

22. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

23. Kabilang na roon sina Lala, Dada at Sasa.

24. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

25. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

26. Masarap ang pagkakaluto mo ng kare-kare.

27. Umayos naman ako ng higa at yumakap patalikod sa kanya.

28. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

29. Nationalism has been a driving force behind movements for independence and self-determination.

30. Tumahol ang aso at natakot ang pusa.

31. La realidad es que a veces no podemos controlar lo que sucede.

32. Mayroon kaming bahay sa Tagaytay.

33. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

34. Bawal magtapon ng basura sa hindi tamang lugar dahil ito ay maaaring magdulot ng sakit at katiwalian.

35. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

36. The store has a variety of sizes available, from small to extra-large.

37. The beach has a variety of water sports available, from surfing to kayaking.

38. You got it all You got it all You got it all

39. Después de la lluvia, el sol sale y el cielo se ve más claro.

40. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

41. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

42. Makinig ka sa 'king payo pagkat musmos ka lamang.

43. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

44. Le travail est une partie importante de la vie adulte.

45. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

46. Aquaman has superhuman strength and the ability to communicate with marine life.

47. Ang pagpapakain ng mga biko at tikoy ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

48. Gustong pumunta ng anak sa Davao.

49. Let's not ignore the elephant in the room any longer and confront the issue head-on.

50. There's no place like home.

Similar Words

popularize

Recent Searches

popularmostinommakakahealthkaybilisnagpaiyakmagulangmakasalanangcashhomeworkpasyentetsinatinutopgisingdondeactivitynakauslingalamnaligawayachickenpoxbanallintapinatirageneratedchadstudiedbaitbukakanagmamaktolsponsorships,tangingbeautydahontumulakjohnyumanigmagsaingdinanasmatayognanaisinkongaffiliateplanning,nakakapasokseasonkonsultasyonmarasiganadangvalleymagtanghaliantransitunti-untingbuntisnagbiyahemini-helicoptertaoscapitaliststringmestmagsunogmagpapabunotderaabotginagawafulfillmentthanksampaguitanag-aabangkaliwakasuutandelelockdownpuedenbagamatnilalanghigh-definitionourandamingpresscountriesnagtungonasiyahancarriesumiinomhumabolnapaplastikangenerabalumikhaobserverercryptocurrency:panginoonremotesumisiliplalabhanbinuksanangalmagbantaybumabahapaoslubosmayabongnasabingtatlongapelyidonowendingbulsamahuhusaypigingnagulatdumatinglayunininiirogbaulestablishedkasaysayanpara-parangvitaminbilangindevicesnabasainitlaromumuranakakatulongindependentlyasiaticadditionallysimoncommunicationsneverkundipagpalitkababaihanandreahetohirampoorerparaangsumusunodmakatarungangjokediferentesnakapangasawasisentakagyatnaglaholumbaybalahibobwahahahahahacitizenconsideredtigasumuwiincreaseilihimwealthsharingpeternohangnagtinginannaguguluhangwayspondoalaynagmungkahiginangklaselunesnatatakotroughempresasvanrestawangamotproporcionarmirakasiinaabutanmganangangalitstaplecrucialheartpinagtagpomahusayrelativelyfurtherparusahanibinaonpangangatawanaudio-visuallyprogrammingmadadalaminamahalnatingalanakataas