Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Pinagpalaluan ng bayan ang kanilang mayor dahil sa kanyang mga proyekto at serbisyo publiko.

2. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

3. Hindi ko na kayang itago ito - sana pwede ba kita ligawan?

4. Kailan nangyari ang aksidente?

5. Umalis siya upang hanapin ang sandok na hinahanap.

6. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

7. Ma, wag mo akong iwan. Dito ka lang ma!

8. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

9. Los trabajadores agrícolas se encargan de cosechar los campos a mano.

10. Siya ay nagdesisyon na lumibot sa paligid ng bayan upang makakuha ng impormasyon para sa kanyang proyektong pang-eskwela.

11. Ginaganap ang linggo ng wika ng Agosto.

12. Lumapit siya sa akin at sumandal sa may sink.

13. The woman walking towards me was a beautiful lady with flowing blonde hair.

14. Araw-araw na bumalik ang prinsesa sa kagubatan hanggang ang bulaklak ay napalitang ng bunga.

15. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

16. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

17. Det er vigtigt at skabe en inkluderende og støttende samfund for transkønnede personer og bekæmpe diskrimination og intolerance.

18. Hindi ko gusto magpakita nang bastos, kaya sana pwede ba kita makilala?

19. Effective communication and teamwork are important for a successful and productive work environment.

20. Nais sana kitang isama subalit hindi talaga maari ang mga kagaya ninyo sa aming kaharian.

21. Mahalaga ang regular na pagsisipilyo at paggamit ng dental floss upang maiwasan ang mga sakit sa bibig.

22. Lumiwanag ang langit pagkaraang umalis ang ulan.

23. Ilang beses ka nang sumakay ng eroplano?

24. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

25. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

26. Hindi ako pumayag na hiramin ang aking laptop sa aking kapatid dahil baka masira ito.

27. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

28. Maraming mga uri ng droga, tulad ng marijuana, cocaine, heroin, at methamphetamine.

29. Have we seen this movie before?

30. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

31. Pnilit niyang supilin ang hangaring makasilong.

32. Ang mga lugar na madalas tamaan ng buhawi ay kailangang magkaroon ng mga pinalakas na imprastruktura at mga hazard mitigation measures.

33. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

34. Ang pamamaraan ng kasal ay nag-iiba sa iba't ibang kultura at relihiyon.

35. Pilit mang hinila ng prinsipe ang kamay ay di nito magawang makawala sa pagkakahawak ng prinsesa.

36. Habang nagbabaga ang araw ay isinakripisyo ng misyunero ang abang buhay.

37. Nang malapit na siya, nagtatakbo ang dalaga at nawalang parang bula.

38. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

39. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

40. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

41. Sa matinding sikat ng araw, tila sya ang mandirigmang sugatan, ngunit matatag na nakatindig sa pinagwagihang larangan.

42. Halos wala na itong makain dahil sa lockdown.

43. Kangina pa ako nakapila rito, a.

44. Ang ilalim ng kanyang payong ay nagsilbing lilim mula sa malakas na sikat ng araw.

45. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

46. Wala yun. Siya naman talaga ang may kasalanan eh.

47. Wag kang tumabi sakin! paguutos nito.

48. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

49. Noong una, sinasagot niya ang mga panunuksong ito.

50. May mga taong may agam-agam sa mga pangarap nila sa buhay kung ito ba ay magkakatotoo o hindi.

Similar Words

popularize

Recent Searches

popularbestidanageespadahannariningmanatilihimutoknag-ugatnagsisihannakukuharedspareestoshinoglumabanphilosopherlateincreasespreadservicesbookmangangalakalpagkakalutohanplatokatagadalhantinitindasabadosuotsarilimegetperwisyoappallottednaglutobitiwanluluwasnapakagagandananlilisikerlindanagtungomagpaliwanagpamburanakatalungkokinauupuaninirapannaiyakpwedeutak-biyayesnakuhaideyapaidinuulcermaibibigaymagpalagodisfrutarayudaunidosnalugodmanahimikmusicalesnababakaskumakainapollogelaitog,seryosongpagbabantapisaranatitirangkarapatangmaskinertilitawaninakamalayanahhhhtitomalasutlalalimpayongboyfriendmapag-asangtinigilwebsitepaladpaskomayroongtsaasumagotkananestilosorganizebutigreatlyrememberednakinigkontinentengbowpupuntahanmatindialaalabilireguleringcompositoresiyanespigasmaisutilizasumusunodmansanasipinabalikwidespreadpagemestleukemiakidlatnakabasagumanohinaobservation,pupuntainumin18thpasananodinaladollarorderexpectationsresponsibleeitherkitfourcomputersvistmatalinomataliklucasfollowinglagnatmatitigastandangtaksitonightutilizansandaliaudio-visuallynakatayoresearch,hamonpinapalopalibhasadiliginhanda4thetsyinventiontelefonyamankasingtrabahodilawsugatpunung-punopinakamaartengnagtutulunganlumalangoysobrangtinitirhandahanyatamaaarikulaykelanmakakawawapaga-alalanagkakakainhumalakhakpagpapatubomalapalasyopangyayarimasaksihannaglakadnakangisisasakyanpagamutanmagbibigaymaipapautangnami-misskatotohanannangingitngitnatutulogmabagaladoptedmagbayadtatlumpungnegosyantenakalipas