Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. He applied for a credit card to build his credit history.

2.

3. Anong oras natutulog si Katie?

4. Limitations can be financial, such as a lack of resources to pursue education or travel.

5. Vous parlez français très bien.

6. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

7. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

8. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

9. Mabini ang sumulat ng konstitusyon ng unang Republika ng Pilipinas.

10. Hindi ko alam kung magiging okay ka dito, pero gusto ko lang itanong - pwede ba kita ligawan?

11. Nakikini-kinita niya ang paghugos ng mga mangingisda.

12. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

13. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

14. Matuto kang magtipid.

15. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

16. Mas mahalaga ang kabutihan ng kalooban kaysa sa kababawang kasiyahan.

17. Kelahiran bayi adalah momen yang sangat penting dan dianggap sebagai anugerah dari Tuhan di Indonesia.

18. Les universités offrent des programmes d'études en ligne pour les étudiants à distance.

19. Esta salsa es muy picante, ten cuidado.

20. I woke up to a text message with birthday wishes from my best friend.

21. Naputol yung sentence ko kasi bigla niya akong kiniss.

22. Lakad pagong ang prusisyon.

23. The experience of bungee jumping was both terrifying and euphoric.

24. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

25. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

26. Magsabi ka ng totoo, kung di ay dadalhin kita.

27. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

28. The presentation was absolutely flawless; you did a great job.

29. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

30. Ang mga hudyat ay maaaring maging bahagi ng kultura at lipunan, na may iba't ibang kahulugan sa iba't ibang konteksto.

31. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

32. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

33. Hinahangaan siya ng marami dahil sa kanyang pagiging mapagkumbaba kahit galing siya sa mababa na estado ng buhay.

34. Naramdaman ko ang kanyang malalim na halinghing sa telepono.

35. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

36. Einstein was an accomplished violinist and often played music with friends and colleagues.

37. The king's legacy may be celebrated through statues, monuments, or other memorials.

38. Peace na tayo ha? nakangiting sabi niya saken.

39. Las hojas de mi planta de menta huelen muy bien.

40. Masama ang pakiramdam ko kagabi kaya ako ay biglaang nagpunta sa ospital.

41. Mucho gusto, mi nombre es Julianne

42. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

43. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

44. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

45. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

46. Nagkaroon ako ng agaw-buhay na pagkakataon na makapag-aral sa ibang bansa.

47.

48. may butil na rin ng pawis sa kanyang ilong.

49. Kumanan kayo po sa Masaya street.

50. Maganda ang kulay ng mga puno sa panahon

Similar Words

popularize

Recent Searches

popularpoliticalprotestacondapit-haponmahawaankwebangnakangisinghihigalagingroonpasensiyabridetataasarkilamalapitanitinurolingidwriteclasessedentaryeffektivmalakingh-hoyfrescobooksmakingipinadakipgeneratedtiningnanbayanbasketballnagngangalangyouipagmalaakikumainphonetagtuyotmagkipagtagisannangyariefficienttibokaminglugawsadyang,lumingonmabatongbroughtnatanggapipanlinissinunodmalapadkilongfranciscoibinigaynagtataejulietniyonliligawanlibertyvaliosaimpactkumaennanigasandreaemocionalibabawwaitermaongbutoquarantinebarangaynakabulagtanghubad-barokayang-kayangnanamanasignaturahayaanmaghahatidmatagpuannakakatabadaramdaminnakatulogpumapaligidjocelynnahigaaminasiaticpublishing,patawarindiferentesisinusuotpinauwipalapagtumakbonovemberkaniyamaghatinggabimatalimmayabangbinataktarcilapaksalumilingonsupremekasingtigasresumensemillaspresyobotepayadditionfridayhamakchangeeasierbinabaanayudaspendingnasaalignscommerceeksamsutilmaligayabinibiyayaanmapheftymediumminatamispneumoniacallingmabutingbakitcombatirlas,alingtandangmaunawaanyankalaunanpamilyagandapinag-aaralankinatatalungkuangnapasubsobinaabotcultivonapamaliliitgongelvistignanbelievednakakabangonshouldifugaonagbantayilangalituntuninoponapadpadiikutaniloilopanalangincompartencigarettepalitaniyongpapayapalawanbagamatgitarakaymaputiednailanpresidentemagka-apokesocondokasalukuyangbumigaybanlagtechnologydaangibinibigaypresence,nagsagawasalaminkulturnatatawanakitulogmasasabi1929grinsbilugangwarinapatingalamanualmakilala