Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

2. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

3. Stuffed Toys, Mini-Helicopter, Walkie-Talkie, Crush Gear, Remote Controlled Cars, at higit sa lahat, ang Beyblade.

4. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

5. Les enseignants sont formés pour répondre aux besoins individuels des étudiants.

6. I received a lot of gifts on my birthday.

7. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

8. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

9. Sa larong sipa, ginagamit din nila ang maliit na bola ng goma.

10. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

11. Omelettes can be enjoyed plain or topped with salsa, sour cream, or hot sauce for added flavor.

12. Sa gitna ng bukid, natatanaw ko ang mga kalabaw na umaararo sa lupang sakahan.

13. Limitar la ingesta de alcohol y cafeína puede mejorar la salud en general.

14. Mataman niyang inisip kung may iba pang nakakita sa nangyari.

15. Beast. sabi ko pagkalapit sa kanya.

16. Hindi mo sadyang nakuha ang isang mataas na marka sa pagsusulit.

17. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

18. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

19. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

20. Nagulat siya ng makita niya ang isang usa na malapit ng kainin ng isang tigre.

21. Mula sa mga puno, naglipana ang mga bunga na naglalagay ng kulay sa kapaligiran.

22. Members of the US

23. Inflation kann auch durch eine Erhöhung der Arbeitskosten verursacht werden.

24. Ang sugal ay maaaring magdulot ng pagsisira sa relasyon at pamilyang pinansyal.

25. Sa kanyang harap, pinagmamasdan niya ang mga kumikislap na bituin sa gabi.

26. Sige sa Jolibee tayo. sabi ko.

27. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

28. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

29. Nang maglakad ako sa tabing-dagat, nakakita ako ng mga maliliit na alon na mayabong na puting espuma.

30. The telephone has undergone many changes and improvements since its invention

31. Sige, tatawag na lang ako mamaya pag pauwi na ko..

32. Sweetness is an important factor in the culinary arts and food industry.

33. Ang daming pusa sa bahay nila Jocelyn.

34. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

35. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

36. Walang mahalaga kundi ang pamilya.

37. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

38. Ibibigay kita sa pulis.

39. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

40. Namumuo ang pawis sa kanyang anit at sa ibabaw ng kanyang nguso.

41. Ang kalawakan ay punung-puno ng mga bituin.

42. Scissors are a cutting tool with two blades joined together at a pivot point.

43. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

44. Nagtatrabaho ako sa Mimosa Family Home.

45. Umiling siya at umakbay sa akin.

46. TikTok has inspired a new wave of viral challenges, from dance routines to lip-syncing.

47. Work-life balance is important for maintaining overall health and wellbeing.

48. Kailan itinatag ang unibersidad mo?

49. Sa Pilipinas ako isinilang.

50. Napaiyak ako dahil sa pelikula.

Similar Words

popularize

Recent Searches

limahanpopularpalabuy-laboynamumulaklaknaglipanalabimaynakakapagodtrainspalasyotalapagawainpapalapitnagbentapointbisikletabanaltumulongyungkargahannutsnakakondisyondilasinapokkirotmagkipagtagisanrightsspaghettinapatinginpalanagpasensiyaalaslikelykahalagaamoyartistakainnaintindihanpasyalanmakatulongtagalabamapagkalingababaetryghederapbotongmalakingtaon-taonnaguusappoliticsbumabalotmasarapcommunityitinuringpowersbinulabogelevatornagibangbutilmaintainpangkaraniwantangkabastalaterdumarayolumalakadamendmentspilingulaplenguajekulungantinulak-tulakkindsipinadalamagsi-skiingminerviemangingisdamonitormahirapcountrynasasakupant-shirtkablancondoliligawanbawamenosligayakahongabanganpinyabawianetokasintahanjoynakaangathardinculturakalongprocessbusyangrolandfindmartiankalalakihanpaghingibarungbarongganoontakottiyaktuktokpinakamahalagangpananakotrightangalmukalumulusobpapanhikmapamag-asawaconnectionuponmagkahawakseekcalciummemorialredesimprovekwebakumantakumaripasricalandasculturespinapalosalekumukulonakalipaskumukuhahagdananleadingbasketboltravelermesastokwenta-kwentanagpepekemasamangnangapatdankinasisindakanfigurepamagatmakaraanwasakhinahaplossinusuklalyansurveyshigapagodmahiwaganabasanabigyanlamesabigotenakikini-kinitaumarawsakopmulighedbritish3hrslibangansiguronakahigangtinignanipabibilanggofacemaskpangakokalabawrichmotionmaipantawid-gutomnagdaramdamayanpanunuksoworkdaypangungusaphinamondagailannagbababamensajesmaputicutmalusogimpormulti-billiongymisusuotingatan