Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. La realidad siempre supera la ficción.

2. Many financial institutions, hedge funds, and individual investors trade in the stock market.

3. At blive kvinde kræver også mod og selvstændighed.

4. Kinagalitan si Bereti at pinauwi ngunit ayaw sumunod ng bata.

5. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

6. Maaari bang hawakan ang iyong mga kamay.

7. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

8. Inakalang masaya siya, pero sa likod ng ngiti ay may lungkot.

9. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

10. Nakarating na si Ana sa gubat at pumasok sa isang kweba at lumabas ng may dalang basket na puno ng ibat-ibang uri ng gulay.

11. Naglaro sa palaruan ang mga bata nang limahan.

12. Bakit siya ginaganoon ni Ogor?

13. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

14. Ipinakita nya ang determinasyon sa larangan ng boxing.

15. She does not use her phone while driving.

16. I discovered a new online game on a gaming website that I've been playing for hours.

17. Tanggapin mo na lang ang katotohanan.

18. Musk has been involved in various controversies over his comments on social and political issues.

19. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

20. Sayang, tolong maafkan aku jika aku pernah salah. (Darling, please forgive me if I ever did wrong.)

21. May gusto lang akong malaman.. I have to ask him.

22. Ang lahat ng problema.

23. Gumawa si Mario ng maliit na bola mula sa papel.

24. Pinaliguan ni Simon ang sanggol.

25. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

26. Humihingal at nakangangang napapikit siya.

27. Hindi dapat magpabaya sa pag-aalaga ng kalusugan sa pamamagitan ng regular na ehersisyo at malusog na pagkain.

28. Saan pupunta si Trina sa Oktubre?

29. Sa gitna ng gubat, nagbabaga ang apoy na ginagamit nila upang magluto.

30. The store was closed, and therefore we had to come back later.

31. Nagsusulat ako ng mga kwento at mga katha upang palawakin ang aking imahinasyon.

32. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

33. Magalang na nangumusta si Ana sa kanyang mga magulang pagkatapos ng isang mahabang biyahe.

34. Napatulala ako sa kanya. Di ko alam ang isasagot ko.

35. Mabilis ang takbo ng pelikula.

36. "A dog's love is unconditional."

37. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

38. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

39. Sabi ko bumangon ka jan! Hoy!

40. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

41. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

42. Nagsusulat ako ng tula bilang pagpapahayag ng aking damdamin.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. Ayoko na pong maging pabigat sa kanila.

45. Nanalo siya ng award noong 2001.

46. Mahirap magsalita nang diretsahan, pero sana pwede ba kita ligawan?

47. Ang biglang pag-alsa ng mga manggagawa ay binulabog ang industriya ng paggawa.

48. Tumama ang siko nito sa kanyang dibdib, sa kanyang katawan! Dali-dali siyang tumalikod at patakbong lumabas.

49. Eine starke Gewissensentscheidung kann uns helfen, unsere persönlichen Werte und Überzeugungen zu verteidigen.

50. Don't worry about making it perfect at this stage - just get your ideas down on paper

Similar Words

popularize

Recent Searches

naguguluhangpopularmaghahabihawlakulanginastakaklaseipinanganakmaghapongreportinaabotnakatulogbahagyangjagiyafredflamencowaysnandayabibilhinpagsusulittumatanglawyelosukatmapuputinagliliwanagrobinhoodpaglingonnamasusunduinalaynagtungonahulogmakatulogdiagnosesmagbaliknapatulalakalalakihanetomagisingomelettekarnabalnatayoinfluencenabigayingatanhayencuestasmakikipagbabagpayapangtibokkumidlatpagtutoldigitaliikotnakatingingbagomagalitattentionpulitikotrajepaki-translatematataguncheckedmanakbosatisfactionencounteritinalidoktormakakibomininimizebackoperativostindaguiderightsbalik-tanawlegislationmagamotreservationpatunayanmananaloleolimosengkantadaallowingumagaiatftawananmay-bahaydontdeterioratemanilanapakalusogfireworksmanalopopcornmalakingevilmagbigayanautomationsourceflashsignalinteligentesvotespromisegeneratedon'tmagisipiyotrycyclecassandratypesnapapansinleftcontinuedformatmichaellabasquicklyunidosipaghandagubatlandnatandaankoronaapoymensahenakakatandapasanghiwanatalotripinangfrescosellrosakakatapospupuntaechavesantossumusunoneed,gumagawatatlongnasanlibingkatulongmbalokarapatannalalamaniniibigbinibilibayawakenerohitiknaglabaminahanbahagyadiversidadkahusayanstudentmagingtalagauniverseteasierneedshouseholdcultivanaiiritangsakupinpresleyninasportsasianakatirangprodujoattractivemagtatakaproducts:putimagpapagupittsinamasayang-masayangpaumanhinmatamannilayuanvetonakuhangbumibitiwmatagumpaykonsentrasyonawitinsalarinroon1980pinagpatuloypanalanginbyggetnahihiyang