Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. I know this project is difficult, but we have to keep working hard - no pain, no gain.

2. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

3. Ang paggamit ng mga aromang nakakarelaks tulad ng lavender ay nagbibigay sa akin ng isang matiwasay na tulog.

4. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

5. Marami akong agam-agam sa aking mga plano dahil sa mga hindi nakasiguraduhan sa buhay.

6. Isang araw, habang nangangahoy si Mang Kandoy, nakakita ito ng isang kweba sa gitna ng kagubatan.

7. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

8. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

9. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

10. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

11. Mange små og mellemstore virksomheder i Danmark eksporterer varer og tjenester.

12. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

13. May maruming kotse si Lolo Ben.

14. Elektronik er en vigtig del af vores moderne livsstil.

15. Marami rin silang mga alagang hayop.

16. Football is a popular sport for both men and women, with many professional women's leagues around the world.

17. In 1977, at the age of 42, Presley died of a heart attack

18. The baby is not crying at the moment.

19. Disculpe señor, señora, señorita

20. Ipinanganak si Emilio Aguinaldo noong Marso 22, 1869, sa Kawit, Cavite.

21. Pinapagulong ko sa asukal ang kamias.

22. Sa mga perya, naglipana ang mga tao na naghahanap ng libangan.

23. Laking galak nito nang matagpuan ang maraming itlog ng bayawak, at tuwang-tuwa na tinirador ang mga itlog.

24. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

25. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

26. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

27. Anong bago?

28. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

29. Siya ay hindi marunong magtimpi kaya't laging nagmamalabis sa pagpapahayag ng kanyang saloobin.

30. Maaf, saya terlambat. - Sorry, I'm late.

31. Mayroon pa ba kayong gustong sabihin?

32. Andre helte er kendt for deres humanitære arbejde.

33. La desigualdad económica y social contribuye a la pobreza de las personas.

34. Nalugi ang kanilang negosyo.

35. Nagpunta ako sa may kusina para hanapin siya.

36. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

37. Hindi ninyo madadala sa hukay ang yaman ninyo.

38. Ant-Man can shrink in size and communicate with ants using his helmet.

39. Ang aking ina ay isang magaling na mang-aawit.

40. Before a performance, actors often say "break a leg" to each other for good luck.

41. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

42. If you're trying to get me to change my mind, you're barking up the wrong tree.

43. Inakalang wala nang pag-asa, pero may dumating na tulong.

44. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

45. No dejes para mañana lo que puedas hacer hoy.

46. Siya ay nagdesisyon na lumibot sa paligid ng bayan upang makakuha ng impormasyon para sa kanyang proyektong pang-eskwela.

47. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

48. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

49. Muchos agricultores se han visto afectados por los cambios en el clima y el medio ambiente.

50. Then the traveler in the dark

Similar Words

popularize

Recent Searches

disposalpopularsumasakitaffiliatebumigayenergipamimilhingdefinitivogapasthmakrusparomustbilaohumblebutchhinogumaagoslumulusobsinabibaryokatutuboyeplamanbusiness,espigasinomchildrenkatandaangrinsdreamattractiveabonojanefridayipanlinismalapadsilbingsanmagdanahulicontestsuchworryneroeeeehhhhreservationcongratssumalibilerchadelectionscigarettesdiliginicehatingpinilinglorenaetodulagenerationerincreasinglyharmfuldenpamilyanaglakadroughconditiondecreasecircleseenreadingfredniceannaactionlilipadkasaysayanilalagayprofessionalpackagingpakilagaymahuhulibakepagkakalutomakahingisumigawipinikityelolasingerobansatrafficpicsconvertidasmaskmaitimtenderabotpapagalitansabadongbangladeshpulang-pulapagkakamalikasangkapanposporomakapaibabawpagkagisingvirksomheder,laki-lakipaulatabinakayukonageespadahanhampaslupanagpalalimnasasabihannanahimikpagdukwangzebrakaharianpagtataasparehonghouseholdskumikilosmagsi-skiingmagpapagupitteknologibusinessesmakakibopangangatawanactualidadnagwagilumamangfestivalesmahahalikmoviemagsusuotnagtalagapinipilitsarilikamaliannawalaumuponakainomnanangisnakisakayinaabotbinge-watchingbisigsasakaytaxituktoknahigitanrektanggulopaglulutousuariosagutinbyggetkanluranmatulungintusongdumilatpayapangsigurolalimlilikopagsusulitmaaksidentemenstawananbutasnahulaanligalignatayonatuloymaglababibilhincompletamenteagilamatipunoambagsinerolandsandalinagisingdasalproducts:angheltigaskasamanuhmagisingbansangmulighederwasakcharismaticltostruggledknightfit