Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

2. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

3. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

4. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

5. Kahit na maliit ang kanyang bahay, basta't nagmamahalan ang mga tao, sapat na iyon.

6. Sa di-kawasa ay dumating ang malungkot na sandali.

7. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

8. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

9. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

10. Ano ho ang ginawa ng mga babae?

11. Mahalagang magpakumbaba at magpakatotoo sa bawat sitwasyon, samakatuwid.

12. The acquired assets have already started to generate revenue for the company.

13. Kapag walang magtutulungan, walang magtatagumpay.

14. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

15. Tulala siyang tumitig sa malawak na tanawin ng dagat.

16. Ang dami daw buwaya sa kongreso.

17. Do something at the drop of a hat

18. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

19. Sa soccer, sinipa ni Andres ang bola papasok sa goal.

20. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

21. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

22. Marahil ay kailangan mong magdagdag ng oras sa pag-eensayo upang makamit ang iyong layunin.

23. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

24. Les régimes alimentaires restrictifs et les comportements alimentaires obsessionnels peuvent nuire à la santé mentale.

25. Sa dakong huli, na-realize ko na mahalaga ang aking mga kaibigan.

26. Ang mailap na kahulugan ng salita ay kailangan unawain nang mabuti.

27. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

28. He is taking a walk in the park.

29. Kumain na tayo ng tanghalian.

30. The company had to cut costs, and therefore several employees were let go.

31. Pagapang na bumaba ng hagdanan ang anak, sa pagsayad ng mga kamay nito sa lupa ay unti-unti itong nagbago.

32. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

33. The park has a variety of trails, suitable for different levels of hikers.

34. Samantala sa bahay, nagluluto siya ng paboritong putahe ng kanyang asawa.

35. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

36. Pwede mo ba akong tulungan?

37. Hindi siya malilimutin dati, ngunit nagbago ito nang siya’y tumanda.

38. Anong oras mo ako ihahatid sa airport?

39. Ang kaaway sa loob ng bahay, ay higit na nakakasakit kaysa kaaway sa labas.

40. We admire the dedication of healthcare workers in the midst of the pandemic.

41. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

42. Itinaas niya ang tirante ng kamiseta.

43. Salud por eso.

44. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

45. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

46. Ipinagbibili niya ang mga ito na may mataas na patong sa mga pobreng mangingisda.

47. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

48. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

49. Nagpakita sa Datu ang Dakilang Bathala at ipinaalam sa ama na ang kanyang anak ay mabubuhay ng labing-siyam na taon lamang.

50. Pakiluto mo nga ng pancit ang mga bata.

Similar Words

popularize

Recent Searches

landepopulartelangelitesweetwestnatanggapiskodiamondisipminutobusloabrilsiemprekadaratingunti-untingcompartenballsumakitelectionslaborlabingeveningstonehamparagraphscardcriticspitakamatapangnyoactivityaddconsiderarelectronicpinunitfistsdaigdigteamfuncionarlastinglibreleenutrientesdumatingtypesfutureoftenmarkedautomaticcontrolaincreasedferrernothingstoplightnaggingupworkcrazyuniversitybio-gas-developinginfusionespinadalagayunpamangasolinahanpangalanhaftpangakomontrealairportbutmaglabanagsilapitrepublicmasinoptennisasahanyumuyukonakaka-innakuhangdi-kalayuandinalanapapatungokinauupuanmagasawangaanhinginugunitarenombremagnakawnakabulagtangkumbinsihinmagpaniwalalaki-lakikalalakihannanangiskumalmachessrecentlyformasnangangakopamumunonagagamitbalediktoryantahananparapresidentepandidiritinakasanricamahinamagdamaganmakakabalikbwahahahahahaaplicacioneshouseholdstinutopkanikanilangnaiilagantatagalmaipagmamalakingnahihiyangmanghikayatdoble-karanagcurvesinasadyakamakailandahan-dahanpronounhigantenasasaktanevolucionadomasaktangawinestasyonsagutinpagbigyanfactoresnagsinestoryisinagotkamandagnapasubsobenviarheypagdiriwangsiyudadnanamanhinalungkathistoriamensemocionesnatinagtutusingelaimahalbayadinhalemasaganangbibilhinvariedadbayaningcompletamenteengkantadagroceryhihigitumabotsumasakaylalimmoneysisentaendvidereobservation,tulogbaryomayamangphilippinetsssyeyjagiyadiseaseeksportenkenjisinagulangkumapitnapilitangalagavetoninongkombinationimagesmalikotsagapaksidentenakasaranatuloginimbitapagputitiningnankalongnakapunta