Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa purgatoryo, inaalis ng Diyos ang mga natitirang kasalanan sa mga kaluluwa bago sila tanggapin sa Kanyang harapan.

2. Ano ang pangalan ng doktor mo?

3. Sa pagtatapos ng araw, nakakapagbigay ng kakaibang kalma ang pakikinig sa musika habang nag-iisa.

4. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

5. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

6. Pasensya na, hindi kita maalala.

7. Minsan, masarap din namang kumain ng nag-iisa para mapag-isipan ang mga bagay-bagay.

8. Ilan ang tao sa silid-aralan?

9. Ang galing nya maglaro ng mobile legends.

10. Ano ang pangalan ng babaeng buntis?

11. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

12. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

13. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

14. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

15. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

16. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

17. Isang tanod ang dumating at sinabing may dalaw si Tony

18. If you keep cutting corners, the quality of your work will suffer.

19. The momentum of the athlete propelled him across the finish line.

20. Kapag nalulong ka na sa droga, mahirap nang makalaya sa hawla nito.

21. Algunas heridas, como las provocadas por mordeduras de animales, pueden requerir de vacunación antirrábica o tratamiento contra el tétanos.

22. El actor hizo un comentario controversial que está llamando la atención de los medios.

23. Habang naglalakad sa gabi, nabigla siya sa biglang pagkabagsak ng mga paputok.

24. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

25. Kayo din po ba ang nagpapakain sa kanya?

26. Ano ang ininom nila ng asawa niya?

27. Wag ka na lang pumunta sa Palawan. aniya.

28. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

29. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

30. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

31. ¿Cómo te va?

32. Kaninang bandang alas-diyes ng umaga.

33. Sang-ayon ako na kailangan nating magkaroon ng sapat na pondo para sa pagpapaunlad ng ating mga komunidad.

34. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

35. Lumalaon ay dumarami ang tao sa paligid at ang pulis na umuusig ay tila siyang-siya sa kanyang pagtatanong at pagsusulat sa kuwaderno.

36. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

37. The patient's family history of high blood pressure increased his risk of developing the condition.

38. Tengo una labradora negra llamada Luna que es muy juguetona.

39. Kasama ko ang aking mga magulang sa pamanhikan.

40. Then you show your little light

41. Kasingganda ng rosas ang orkidyas.

42. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

43. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

44. Les patients sont souvent admis à l'hôpital pour recevoir des soins médicaux.

45. Tara na nga Hon! Mga baliw ata yan eh!

46. Huwag po, maawa po kayo sa akin

47. Der er mange forskellige rollemodeller og inspirationskilder for unge kvinder.

48. Saan pumunta si Trina sa Abril?

49. Ang mga opisyal ng barangay ay nag-organisa ng programa kung saan ang mga residente ay maaaring lumibot sa kalsada para sa pagsasanay sa kalusugan.

50. Sa mga pinagdadaanan natin sa buhay, kailangan nating maging handa sa agaw-buhay na mga pagkakataon.

Similar Words

popularize

Recent Searches

popularasiaticnatigilanlumilingonisamajapansentenceabotbilugangsinampaldahaniiklisignsumakaytapewalongfireworksnahulidisentekalimutannakitapagbahingconnectingnuonsumasambanoobatohangaringpostcardlaryngitisspeedbipolarinterestlulusogwellchoicecafeterialateguardaplaysheibubongchangemuchosencounterbinabaancoachingkokaktransporthumarapprovepasasalamattechnologyfeedbackcreatingscalelayuningraduallymalakingrelativelyboystructurewithoutcuandoclassmatetabahighestthreeinferiorespaumanhindisensyolandlinetumingalanatandaanibat-ibangunti-untingkasamagoshklasrumitemssusunduinulingpinatutunayanmerchandiseincreasesrailmakikiraanipaliwanagrebolusyonlalakitonightairportnakapasanakatiranglabasriyannagsilapitiligtastenniskarapatangauditpag-aapuhaprimasnaglulusaktamarawasahansarongbilanginitutolpumatollarolalaredigeringhongumalisbalingmeetgalitlorithenguestsafterlaterdurilabingformasnagbabasatennagreplymaaringbabayaranmagdaraostvslaylaytsaateachpasanprosperkumaripasbilisirogpaghihingalonanlilisiknakasahodnapakagagandapagkabuhaynahawakantuluyanmagsusunuranmangangahoynagsasagotpagpapakalatpinagmamalakiagwadorpagkakatuwaanmagkasing-edadpatulogmagpagupitmedikalmanatilipangungusapkusinerounattendedpamilihanleksiyonnakikianagpakunotnangangahoyisinulatnagkakasyakonsentrasyonressourcernepatutunguhanpagka-maktolsportsnaglalakadpakikipagtagpotungkodhurtigeremagtatanimhawaiidistanciapaghalikjuegossalbahengengkantadangnami-missconocidossangalabiskailanmankristosamantalangpinansinnalugodnaglaonkapitbahaynapansinlandaspisara