Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

2. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

3. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

4. Ang pangamba ay isang emosyon na karaniwang nararamdaman ng mga tao kapag mayroong posibilidad ng panganib.

5. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

6. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

7. Masipag manghuli ng daga ang pusa ni Mary.

8. Pumupunta kami sa sementeryo tuwing undas.

9. Danmark eksporterer også en betydelig mængde medicinske produkter.

10. Inakalang tama ang sagot niya sa pagsusulit, ngunit mali pala.

11. Si Mabini ay naglingkod bilang siyang "Brains of the Revolution" noong panahon ng himagsikan.

12. Durante las vacaciones de invierno, me encanta esquiar en las montañas.

13. Nalungkot ang Buto nang dumilim na ang paligid.

14. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

15. Sa Chinese New Year, ang mga tao ay nagbibigay ng mga pabuya upang pasayahin ang mga diyos at mga espiritu.

16. Inakalang walang interesado sa kanyang alok, pero marami ang tumawag.

17. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

18. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

19.

20. Ang taong lulong sa droga, ay parang nakakulong sa isang piitan na hindi makalabas.

21. Lalong nagalit ang binatilyong apo.

22. Pagkatapos, dapat mong i-mark ang mga lugar kung saan mo gustong magtanim ng mais at mag-plant ng mga buto sa mga ito

23. Matapos masaksihan ang kababalaghang iyon ay saka pa lang nalaman ng mga kanayon ang pagiging diwata ni Tarcila.

24. Maraming tao ang naniniwala sa kakayahan ng albularyo kahit hindi ito lisensyado.

25. Tengo que tener paciencia para lograr mi objetivo.

26. Ese vestido rojo te está llamando la atención.

27. I am absolutely certain that I locked the door before leaving.

28. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

29. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

30. Magtaka ka na kung hindi pa sya umuuwi bukas.

31. Tila hindi niya gusto ang mga sinabi mo.

32. Ano ang ikinagalit ng mga katutubo?

33. Hindi sinasadyang naglimot siya sa kasunduan na kanilang pinag-usapan.

34. Practice makes perfect.

35. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

36. Have you ever traveled to Europe?

37. Patients may experience pain, discomfort, and anxiety during their hospital stay.

38. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

39. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

40. He does not break traffic rules.

41. They have been studying for their exams for a week.

42. Accepting the job offer without reading the contract was a risky decision.

43. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

44. Viruses are small, infectious agents that can infect cells and cause diseases.

45. Hindi natinag si Kablan sa loob ng kanyang tindahan.

46. Ang hindi magmahal sa sariling wika ay higit pa sa hayop at malansang isda.

47. Sa paghahanap ng solusyon sa mga palaisipan, mahalaga ang tamang pag-iisip, pag-aaral, at eksperimentasyon.

48. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

49. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

50. No puedo controlar el futuro, así que "que sera, sera."

Similar Words

popularize

Recent Searches

popularmagnifynahigakatagamaingatmayamansinunodteacherumakyatnooamparomodernefiaburmanumerosasomgtapatnakapuntatrescapitalitinagoabriluwakvaccinesnatatawaautomatiskkagubatannamumulamanilbihanusuarionagtataenapatigilipinatawagmagpapigilmagpasalamattahanandesisyonanmagpa-checkupmakapangyarihangwalkie-talkiepinagsikapannagkitakomunikasyonnagkakatipun-tiponikinagagalaksinunud-ssunoditinaobbighanigovernorsdamdaminpinapakinggannakangisinghahahabinuksannagdalat-ibangnaliligomasaholpagbabantamaabutantilgangkagalakannakalilipasalikabukinnagsunurannanahimiksalamangkeropagpapakilalakumbinsihinnaglipanangpagka-maktolnakagalawpinakamagalingrequirebienpangyayarimananakawdiretsahanghiwanapipilitanpagmamanehoisasabadnapakamotnakatalungkopagpilikabuntisanmagsusunurantagtuyotpinapasayauulitinprodujoinuulcermedicinesinasabimangahaspagkuwanarbularyopagdudugoibinililumakimakikitulogkumaenvarietypambahaydakilangebidensyamasukoldealkusinaipinambiliincrediblevegastsinapinaulanankontramanaloheartbeatngunitpagkatkinsekendikainisgurobesesnaalisaaisshwonderpaggawabulongnasuklamhinampaslubossaan-saanpagpasokkumapitadditionlargerpedroabitryghedbabaemulbobomightparagraphspinyaclasesbinibiniburgerbataytabiuriditosumangdidfriesirogimaginationmalimitbiggestcadenayesjackypakpakcornersbabainilingdinggindinalamobileworkdayconnectiontrainingbosesaddressitimhelpfulroleexpectationsareaipinalutohatedifferentclientestartedprocessexplainnutsbroadcastsprotestafeedbackaggressiongotrecenttalekakilalasponsorships,pinagtagpokailangantinaasan