Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. The phone rang late at night, and therefore she was hesitant to answer it.

2. Beauty is in the eye of the beholder.

3.

4. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

5. Hindi na nga nakatindig si Aya at sa inis nito ay gumapang patungong hagdanan.

6. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

7. Anong wala! pasinghal na sabi ni Aling Marta

8. Sino ang sumakay ng eroplano?

9. Kasi ho, maraming dapat kumpunihin sa bahay.

10. You can't judge a book by its cover.

11. Samahan mo muna ako kahit saglit.

12. Wala kang dalang payong? Kung gayon, mababasa ka ng ulan.

13. Fødslen kan føre til forskellige fysiske forandringer i kroppen, og genopretningstiden varierer fra person til person.

14. Je suis en train de faire la vaisselle.

15. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

16. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

17. Araw- araw nangangahoy si Mang Kandoy sa kagubatan para gawing uling.

18. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

19. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

20. Kinakabahan ako para sa board exam.

21. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

22.

23. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

24. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

25. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

26. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

27. Ipantalop mo ng kamote ang kutsilyo.

28. Gaano katagal ako maghihintay sa bus?

29. Elle adore les films d'horreur.

30. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

31. Hindi umano totoo ang mga balitang nag-resign na ang presidente ng kumpanya.

32. Baka matunaw ako. biglang sabi niya. Langya gising pala!

33. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

34. Batang-bata ka pa at marami ka pang kailangang malaman at intindihin sa mundo.

35. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

36. Hindi malinis ang mga tsinelas ni Lori.

37. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

38. Bakasyon ko na sa susunod na buwan.

39. O sige na nga, diba magkababata kayo ni Lory?

40. Cryptocurrency operates independently of central banks and governments.

41. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

42. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

43. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

44. Palibhasa ay may kakayahang magpahayag ng kanyang mga kaisipan nang malinaw at mabisa.

45. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

46. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

47. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

48. The beauty store has a variety of skincare products, from cleansers to moisturizers.

49. A couple of candles lit up the room and created a cozy atmosphere.

50. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

Similar Words

popularize

Recent Searches

vetopopularmayamangpasaheronaninirahancovidkundimanbatisolidifypolvostobaccokapamilyaurihihigitarawlimatiktiboksuzettepitakapakelamnagniningningabalasumugodtaletambayannasundounti-unticontinuenapahintoasimlibrepointmalamigclaraestasyonngipingtotoonauwibumugananghahapdimukahpanamadogssponsorships,ipinanganakproduceosakaniyanapalitangheartdiliginmarketplacesmerlindacampaignsinstitucionessinimulaninteriornakapasahinukaynagbanggaannaantignahigitanpwedepagamutansalbaheh-hoysummitnovellesvedpasanbalebarriersrightstvsfamecolourpulangngunitmatalinopumatoldrayberipinikitnapakagagandanatutulogatensyonpinakamaartenglabinsiyammoderninferioresnapadaanstoplighthahatolgawainbroadcastsnaliwanaganpropesorbalahibotibigpangittusindvisutak-biyadetteautomaticaudio-visuallystaterektanggulomulighederulopamamagitanbisikletaaffectparaisorestdugochunmagsungittamarebomoviegulomuntinlupatopicisulatprobablementepassionpagpililumiwanagpaumanhinregulering,musicalestiyanmgabuenaanumaniskodyiphvernalalabingpakisabibuwalnapilinuninislingidtag-ulanhalakhaknitongpagguhitsupremenagtuturolatestluismagtipidsumimangotmahawaantiyaksementeryomaalwangpatakbongoponanlilimospatakbobibigyanumangatbiensikathopekinakainencuestasikatlongpossiblepinagmamasdannakakatakottuwidnakatingingnanunuksonatingmakasalananggodtmagdilimsilanakapilanangyarisanaworkjunjuntulongcassandramakisigpilinglefttradefireworksnabalitaanbusabusinmagalangkarangalancombatirlas,butoresult