Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ailments can range from minor issues like a headache to serious conditions like cancer.

2. Parehas na ayaw magbigayan ang dalawang pangkat at pinipilit na sila ang mas nararapat kaysa sa isa.

3. Ang taong may mabuting asal, magpapakilala sa kanyang bayan.

4. Ang mga marahas na eksena sa mga pelikula ay maaaring magkaruon ng masamang impluwensya sa mga manonood.

5. Napakabuti ng doktor at hindi na ito nagpabayad sa konsultasyon.

6. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

7. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

8. Some people have a sweet tooth and prefer sweet flavors over others.

9. Representatives participate in legislative processes, proposing and voting on laws and policies.

10. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

11. Hindi mo sadyang nakuha ang isang mataas na marka sa pagsusulit.

12. Guten Morgen! - Good morning!

13. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

14. Ano ang mga ginawa niya sa isla?

15. El arte abstracto se centra en las formas, líneas y colores en lugar de representar objetos reales.

16. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

17. The stock market can be used as a tool for generating wealth and creating long-term financial security.

18. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

19. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

20. Nagsagawa ng seminar ukol kay Marites sa pangangalaga niya ng kalikasan.

21. Wasak ang kanyang kamiseta at duguan ang kanyang likod.

22. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

23. ¡Feliz aniversario!

24. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

25. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

26. Women have faced discrimination and barriers in many areas of life, including education and employment.

27. Hindi ako nakatulog sa eroplano.

28. Wives can be loving, supportive, and caring companions to their spouses.

29. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

30. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

31. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

32. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

33. Nagpaluto ako ng adobo sa nanay ko.

34. Ganoon ng ganoon ang nangyayari.

35. Tatlong araw bago dumating ang ikatlong Sabado, sorpresa ko siyang dinalaw.

36. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

37. The website's online store has a great selection of products at affordable prices.

38. Iwanan kaya nila ang kanilang maruming bayan?

39. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

40. Endelig er Danmark også kendt for sin høje grad af økologisk bæredygtighed

41. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

42. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

43. The pursuit of money can have both positive and negative effects on people's lives and relationships.

44. Nakasuot siya ng pulang damit.

45. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

46. Sadyang mahirap ang pag-aaral ng calculus, ngunit sa tulong ng tamang libro, maari itong maging mas madali.

47. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

48. Mayroon ba kayong reaksiyon, Senador Ferrer?

49. Hinanap niya lahat ng kabarkada niya sa sugal at sinisi sa nangyari sa kanya.

50. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

Similar Words

popularize

Recent Searches

popularmaingatyarisandalitapatfonosbinilhanindialumulusobmapahamaklatestcryptocurrencyorugapetsangsangitinagonatawaissuesclientesimpitmulti-billioninternetbringnuclearsinabipaligidgamedidfriesbileramongginisingtrafficbabasahinamparoheartbreakcontinuestringlearnactorstoptoolcontentkutistagumpaybumototumatawadnunobatalangulaypinyuanreservesiba-ibangmuraganitomamihangaringsabilonggirisalituntuninadecuadowariniceworkingmalapalasyomakakaincultivarunosdalawampumatuklasanhinampastrainingteleponomarurumikatagangmabaitpinagmasdandumilatconditionkanayangelectronicmagsusunuranbeforeletteronlinedoktortherapysino-sinotahimikusuariosaan-saannag-aaralseniorpulanghinanappitumpongyelonakapuntatagtuyotburmacomienzanendsorrylibrokindlekinumutanlegacykatuwaanperohumalikliigstonehamjamesnapatigilbahaymalinisestosnapakagandangkamoteukol-kaygandahannagpabotcourtvaccinessaranggolanakapangasawangunitnangagsipagkantahangratificante,biglaankinalakihanmaranasannaglalaronalalamanmagkaibapagkamanghahinagisnatatanawakmangcynthialumikhanawawalagulatdamithulunangyarikumakantanapapahintoikawmasaktannagwalistaglagaskabiyaksumasakay3hrsbihirabutterflymeaningtiyanmaatimturonnaiwangpagkatapospaulit-ulitnenavetotinapaytransportationganablusahmmmmiyantuwangimportantesminahansilbinginantoksurgerygodmagbungabinigyangknow-howreservationmakilingmentaldaangmakulonglugarpautangmemorylabanankithadreportencompasseskumakainmungkahisalitakonsyerto