Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

2. Børns leg og kreativitet er en vigtig del af deres udvikling.

3. Mas malaki ang silid-aralan ngayon kumpara sa dati dahil sa pagdami ng mga estudyante sa paaralan.

4. Ano ang pinabili niya sa nanay niya?

5. Nag-reply na ako sa email mo sakin.

6. Sa mga lugar na mayroong tag-ulan, kadalasang tumataas ang presyo ng mga prutas at gulay dahil sa hirap sa pag-ani.

7. Puwede ba siyang pumasok sa klase?

8. Il fait beau aujourd'hui, n'est-ce pas?

9. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

10. Bawat galaw mo tinitignan nila.

11. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

12. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

13. La Navidad y el Año Nuevo se celebran en invierno.

14. May email address ka ba?

15. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

16. They plant vegetables in the garden.

17. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

18.

19. Masyadong maaga ang alis ng bus.

20. Sa kalikasan, mahalaga ang mga punong-kahoy dahil ito ang nagpapakain sa iba't ibang uri ng hayop at insekto.

21. Ang mga bata ay kailangan ng maagang edukasyon tungkol sa pag-aalaga ng kanilang ngipin.

22. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

23. Unti-unti siyang palayo sa pangkat dahil nais niyang mapag-isa.

24. Mahalaga ang pag-aaral ng talambuhay ni Marcelo H. del Pilar upang maunawaan ang kanyang papel sa kasaysayan ng Pilipinas.

25. Nagagalit ako sa mga sakim na mga minahan.

26. Nasarapan ako sa luto ni Chef Josh.

27. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

28. Ang mga palaisipan ay hindi lamang nagbibigay ng hamon sa ating kaisipan, kundi nagbibigay rin ng mga oportunidad para sa pagpapalawak ng kaalaman.

29. Tumahol ang aso at natakot ang pusa.

30. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

31. Goodevening sir, may I take your order now?

32.

33. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

34. "Ang kabataan ang pag-asa ng bayan," ani ni Jose Rizal.

35. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

36. El estudio de la música ayuda a las personas a desarrollar habilidades importantes, como la creatividad, la concentración y la capacidad de trabajar en equipo

37. My grandma called me to wish me a happy birthday.

38. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

39. He is typing on his computer.

40. Kailangan kong harapin ang aking mga agam-agam upang hindi ako magpakita ng kahinaan.

41. Guten Tag! - Good day!

42. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

43. Natutuhan ng mga mag-aaral ang talambuhay ni Heneral Luna at ang kanyang ambisyon para sa pagbabago ng bayan.

44. Naging bahagi siya ng agaw-buhay na rescue mission upang iligtas ang mga tao sa panganib.

45. Sige sa Jolibee tayo. sabi ko.

46. El algodón es un cultivo importante en muchos países africanos.

47. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

48. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

49. They do not eat meat.

50. Ang daming kuto ng batang yon.

Similar Words

popularize

Recent Searches

popularilocoslegacyltobrainlybatobinigaybilinfuelwalngfiaultimatelylingidpopularizehidingpalapitbigpollution4thcontinuesmapadalikumarimottabascomekumaripasipinabaliksorrylisensyasimplengcommunicateniceblessdosspeechsteerpeterdarktrainingartificialmatangkadnaalisjunenoodmedyomaasimlagirecentpaulit-ulitbuwismagingpaskomaramotmagdamagankalakihanlumiwagbungangmalalimngunitdoble-karanatinagumikotsakalingvirksomhederkassingulangkindergartenisinamainsidenteinuminfollowedbinawianpalakatoothbrushcompanyibinalitangpundidonakagawianmassesmalumbaysiembrayesbasahinpagdiriwangressourcernecoaching:spiritualpagpapakalatnagkitamagkakaanakkumembut-kembotpagsalakaynapatawagnakatuwaangtinaasannanghihinamagkakailanagtatamponangangahoypare-parehoikinasasabiknagpapaigibkumikilostatayokinakabahanyumabongnagkasunogpaglalaitdadalawinpagkapasokmaliksinalalabilumitawdahilnaglalaroinatakebuwangurotaga-lupangmabilispalagipandemyajeepneyideologieshabitsinusuklalyanumiimikpangungusapmakabawimangahasmakikitulognapasubsobsharmainekatuwaanmananakawleaderslarawanmag-alaspagkatotsospillpasukansakitorderkakilalaenglishtig-bebeintetinatanongtumamisibinaonpaciencianakahainjejuumigtadpeksmannataloniyoitinaobhinatidiikotnaawalibertymagpakaramitanghaligagamitsamantalangnakariniginfusionesmagdaanopportunitymagsimulakubonatayopangalananlumbaymukhahumigasahodnangingitngitathenapangilituturokargangelenapaldatigasnaturalthroatkenjiricobutimagdalatshirtfauxpalaywalongmaskiautomationmagbigayanbilibstruggledmagising