Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Pagputi ng uwak, pag-itim ng tagak.

2. Nasa ibabaw ng mesa ang bag ni Clara.

3. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

4. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

5. Marahil ay hindi niya naaalala ang pangalan mo kaya't dapat mo siyang i-pakilala.

6. We need to reassess the value of our acquired assets.

7. Nakagawian na ng prinsesang mamitas at mamasyal sa tila bang perpekting hardin para lamang sa isang prinsesang katulad niya.

8. There were a lot of toys scattered around the room.

9. Sebagai tanda rasa terima kasih, orang tua bayi akan memberikan hadiah atau makanan khas kepada para tamu yang hadir.

10. Di ka galit? malambing na sabi ko.

11. Maramot siya sa pagkain kaya hindi niya binibigyan ang kanyang mga kapatid.

12. Ang daming tao sa peryahan.

13. Nagbago ang anyo ng bata.

14. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

15. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

16. Ang puso niya’y nagbabaga ng pagmamahal para sa kanyang pamilya.

17. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

18. Bumagsak ang dilim sa kalsada ng biglaan kaming tumama sa ilaw ng poste ng kuryente.

19. The company’s momentum slowed down due to a decrease in sales.

20. Hi Jace! Mukhang malakas na tayo ah! biro ko sa kanya.

21. Oy saan ka pupunta?! sigaw nya.

22. Nakisakay ako kay Jose papunta sa airport.

23. Nakuha niya ang mataas na grado sa pagsusulit, bagkus hindi siya gaanong nag-aaral ng mabuti.

24. Saka dalawang hotdog na rin Miss. si Maico.

25. Pinili kong magtrabaho mula sa bahay upang makasama ang aking mga anak, bagkus may mga oras na rin na kailangan akong pumasok sa opisina.

26. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

27. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

28. La decisión de la empresa produjo un gran impacto en la industria.

29. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

30. Ang kaniyang ngiti ay animo'y nagbibigay-liwanag sa madilim na kwarto.

31. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

32. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

33. Sa larangan ng negosyo, ang mailap na customer ay mahirap makuha at panatilihin.

34. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

35. Kayo din po ba ang nagpapakain sa kanya?

36. Erfaring har lært mig at tage ansvar og være proaktiv.

37. Huwag masyado magpaniwala sa mga nababasa sa internet.

38. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

39.

40. All these years, I have been inspired by the resilience and strength of those around me.

41. Mahalagang regular na magpatingin sa dentista upang maiwasan ang mga dental problem.

42. Si prince charming yan noh? pang-aasar ko.

43. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

44. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

45. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

46. Ang ganda ng swimming pool!

47. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

48. Nagsisindi ng ilaw ang mga bahay tuwing takipsilim.

49. They have bought a new house.

50. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

Similar Words

popularize

Recent Searches

populartalentmanananggalsobrabaulsumamamegetleukemiarelocommissiondagasakinfelteffortsownasagamotritodettesukatclasespinyaminutoasimyepisaacnooiguhitespigastumatakbobadtwinklekartondonebulsamakilingfistsleefiguresputahebrucesumangsinong18thsaringsinabipakpakrisklabingkaringuncheckedflexibleadditionsparkmatangmemorybehaviorcurrentrepresentativeconvertingdifferentremotespreadmasterdedicationipinalutogenerabaviewbroadcastsmalakingjohncornerinteriorsamamarkedinspiredderbabafarwaysmagbigayactualidadmodernmakasilongmetropaghuhugassumusunodmagtakanabuhaylunaskapiranggotpinagtatalunantumatanglawbabainggabingsarisaringlalakinag-poutsittingpagegamitinmalawakshoppingnatinna-suwaynilulonferrerbatalansalbaheangkansinampalpaggawanobodykinauupuangpagtuturogaspusongunibersidadnapakasipagmoviemedicinetuyotkalaromaibanicopalayihandaipinangangakpag-akyatamoaddictionconstantdahilbrideasokasiyahannalugmokyeskagandaturokapasyahanobra-maestranakainpaghangailocossiyudadrailwayssongsresignationlinawduonabutanyatasutilpreskomeancontandalendingbarung-barongdumiretsoinakalaibat-ibangfysik,nilimasmalungkotmakainpaostumigildyosaclearnaiiritangnationalbinanggabagamamahabasilid-aralanmarangyangsanggolmedyoipinagbilingfallasulenergiinterpretingpinagmamasdanpapapuntapagkalitohanapbuhayjuanitoempresaspronounnakakatakotde-dekorasyonnapalingonbefolkningen,flyvemaskinersasamahanmagkamalimahiwagang