Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

2. The artist painted a series of landscapes inspired by her travels.

3. The flowers are not blooming yet.

4. Nagre-review sila para sa eksam.

5. Gusto kong tumakbo at maglaro sa parke.

6. The telephone has also had an impact on entertainment

7. Ani niya, wala nang makakatalo sa kanyang kakayanan.

8. Si Jose Rizal ay napakatalino.

9. Dala ito marahil ng sumpa sa iyo ni Matesa.

10. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

11. I can't keep it a secret any longer, I'm going to spill the beans.

12. Naisahan ng salarin ang mga pulis sa kanilang operasyon.

13. Palayo nang palayo ang barko habang papalubog ang araw.

14. Nagkakasya rin ang pamilya na mamulot ng mga tirang pagkain na maaari pang pakinabangan.

15. Scissors are a cutting tool with two blades joined together at a pivot point.

16. Ang digmaan ay maaaring magdulot ng pagbabago sa relasyon ng mga bansa sa isa't isa.

17. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

18. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

19. Uh huh, are you wishing for something?

20. Tiyak daw na bibili sila ng mga paninda niya.

21. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

22. Ang paglapastangan sa mga pampublikong lingkod ay dapat maparusahan nang naaayon sa batas.

23. Ang mga magulang ay dapat maging maingat sa pagbabantay sa kanilang mga anak upang maiwasan ang paggamit ng droga.

24. Electric cars can be equipped with advanced safety features such as collision avoidance and pedestrian detection systems.

25. Sa ganang iyo, may katuturan ba ang kanyang paliwanag sa harap ng hukom?

26. Umuuwi siya sa probinsiya linggo-linggo.

27. Pagod na ako, ayaw ko nang maglakad.

28. Lights the traveler in the dark.

29. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

30. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

31. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

32. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

33. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

34. Arbejde er en vigtig del af voksenlivet.

35. Saan mo dinala ang dinukot mo sa aling ito?

36. They clean the house on weekends.

37. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

38. Gusto mo bang maglaro ng basketbol?

39. May bagong batas na ipinatupad ukol sa proteksyon ng mga manggagawa.

40. Entschuldigung. - Excuse me.

41. La comida mexicana suele ser muy picante.

42. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

43. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

44. Ang pangamba ay maaaring maging dahilan ng hindi pagpapakatotoo sa ating mga pangarap.

45. Nagsusulat ako ng mga ideya at kaisipan sa aking diary.

46. Ano ang isinusuot ng mga estudyante?

47. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

48. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

49. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

50. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

Similar Words

popularize

Recent Searches

nag-replypopularmalihislinawnapailalimmedievalleytetelangcivilizationplacewesteffektivdulot1980animoybotopetsangcupidstudygamesdeathmanuelpasyabiggestipagbilicriticsnilangtools,boyetcallermulighedergenerateupworkmichaelimaginginfluentialenforcing4thdaddynothingjoydonekararatingpalayanpinilingkindledraft,knowledgetutorialsneverextraanotherinterviewingbackexplainskillsimplengbathalacommunicateexampletinulak-tulakalituntunineraninterests,tumatawagnananalongbumubulaleahsasakyannatingaladalagangnakakapagpatibaytinikmanpigingpagtutolnapapalibutanstonehamnagpuntakumukuhamaskaraipapahinganapaplastikannakataasinimbitahinamakjenahealthierlumalakadumigibasalmagpalagobandangvideonagreklamonakunakakaanimsusundonapangitiwesternb-bakitkailanmannamungangayonglightskamiastamangmaubosmedicinekulangpinansinvidenskabgospelconnectionsiempreumaboginomkindergartenpulongnangangahoylegendseducativaspagkalipasadoboseedosuddannelsepakakasalanhumanobinibilidoinghuwebeskaraokemanakbomagbigaykanilapagkaraaalemagkahawakpusangingatankriskanewspaperskatagangmulamensahepinangalananpaligsahanmantikacaracterizasittingmakisigwalangabibataypanghabambuhaybusoffentliglibagitemsmanaloginamaynilahistoriakalarounangrewardingtalinosumasayawtiyakpantalonminervieiyamotkalabanpinipilitginawangnglalabariyanmarmaingeducationlenguajelaranganbestidanetflixmalapitanlimitedcarbongabidisenyokinanapagodentertainmentmagsaingtiniradorpagkakayakapmangangahoymagasawangnagsusulatmagta-trabahonagkitananinirahan