Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

2. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

3. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

4. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

5. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

6. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

7. Naging bahagi ang mga kanta ng Bukas Palad sa aking proseso ng pagsasanay sa pagtugtog ng gitara.

8. Nagbuntong hininga sya, Akala ko naman.

9. Sadyang maganda ang panahon ngayon kaya't magpi-picnic kami sa park.

10. Kapag nakuha na niya ang aking puso saka lamang siya magkakaroon ng kapangyarihan sa mga nilalang dito.

11. Kailangan mong supilin ang iyong galit upang makapag-isip nang maayos.

12. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

13. The team won a series of games, securing their spot in the playoffs.

14. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

15. Natandaan niya ang mga panunuksong iyon.

16. Sya ngayon ay isa nang ganap na doktor.

17. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

18. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

19. Napansin ni Mang Kandoy na ang dugo ng diwata ay puti.

20. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

21. Let's keep things in perspective - this is just a storm in a teacup.

22. Ang aking Maestra ay napakabait.

23. The two most common types of coffee beans are Arabica and Robusta.

24. En invierno, los lagos y ríos pueden congelarse, permitiendo actividades como el patinaje sobre hielo.

25. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

26. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

27. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa, tulad ng mga makata at nobelista.

28. Anong pangalan niya? Maganda siya ha.

29. Emphasis can help clarify and reinforce the meaning of a message.

30. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

31. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

32. Si Hidilyn Diaz ay isang inspirasyon para sa maraming Pilipino, lalo na sa mga kabataan.

33. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

34. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

35. I have been learning to play the piano for six months.

36. Les enseignants doivent respecter les normes de sécurité en vigueur dans les écoles pour protéger les élèves.

37. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

38. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

39. The company used the acquired assets to upgrade its technology.

40. Nung natapos yung pag print, nakita nung babae yung pictures.

41. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

42. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

43. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

44. "May sorpresa ako para sa’yo," ani ng tatay sa kanyang anak.

45. Ang aming angkan ay mayroong mga natatanging tula at awitin.

46. You can't judge a book by its cover.

47. Nangahas ang binata na sumagot ng pabalang sa kanyang ama.

48. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

49. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

50. Sa kasal, ang pagdadala ng mga panulat ay mahalaga upang masigurong makapagsulat ng matatalinong mensahe sa guest book.

Similar Words

popularize

Recent Searches

marmaingtabavistkulayboholpopularlandekaugnayanorganizekabuhayaninatakepuwedelipadnaiinitansisterkasallandvedvarendemapapamanuelmapakaliinalalayanmuchoscallingsatisfactionomelettescientificmagpuntasumamadedication,samuulanibigpinatidinantokbinabaaniwaringtilae-commerce,kinalimutantibokkakayanangkatagangjolibeegasmeneleksyonagostomukhaginabutterflylumbaypangalananninyongnamumulaklaknakapagngangalitkalalakihanikinabubuhaytaga-nayonnabalitaankaarawankawili-wiliapoyikawkaraokeinsektongpagkalitobagsasabihinhampaslupatobacconagmamadalinaupoinferioresliv,minu-minutohumiwalaykinagagalaklumalakileadersnaglokoumakbayabundantenapagtantosharmainemagkakaroonnakabawimensahemedicalmagkasamapangyayaripagtutolnasiyahannasagutanpicturesmarketing:mabatongopisinapakinabangannasaannamuhaymaibibigaygawinmanahimikkumirotmaghahabiumiisodlumayomaibigaykunggelailayasupolumisanbarcelonabefolkningenmaynilahabitstiemposnaawaika-12kampeonnglalabanasilawpaligsahangarbansoscardigannasaangmaglalakadsigurophilippinenaispaldasellingrabbaupuanmatamanmaatimjagiyakinabaryominamasdanipagmalaakibinatilyosandalingperacigarettengipingshopeevehiclesklasrumtinderamaluwangmenosgosh1920ssamakatwidtupelonatandaantagalognagdarasalhdtvmedyoumuwiakmangbaohimutokroquebeingbusilakaidresourcesclientesbadfarpossibledidingtoograceatethereforeborncreateprogramaableipinalititemsberkeleyquicklyhighestincreasesissuesgenerabanaglarolibagagam-agamwhyqualityipagtimplabuwan