Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Comer alimentos frescos y no procesados puede ayudar a reducir el riesgo de enfermedades cardíacas y diabetes.

2. Magandang umaga Mrs. Cruz

3. This has led to increased trade and commerce, as well as greater mobility for individuals

4.

5. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

6. "Dogs are like potato chips, you can't have just one."

7. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

8. Hindi dapat natin pigilan ang ating mga pangarap, kundi pagsikapan nating tuparin ang mga ito.

9. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

10. Lagi nating isipin na ang mga pagsubok sa buhay ay hindi dapat maging hadlang upang maipagpatuloy ang ating buhay.

11. "Ang hindi marunong magmahal sa sariling wika, daig pa ang hayop at malansang isda" ay isang bukambibig na nagpapahayag ng halaga ng pagmamahal at pagpapahalaga sa ating wika at kultura.

12. Mas maganda tingnan ang mga bulaklak sa dapit-hapon dahil kakaiba ang ilaw ng araw.

13. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

14. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

15. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

16. Nagreklamo ako tungkol sa pakete ko.

17. Mabuti pa nga Babe, bugbugin mo na yan. pagbibiro nila.

18. A mi esposa le encanta hacer manualidades como pasatiempo.

19. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

20. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

21. Pinangaralang mabuti ng ina si Kiko na huwag uulitin ang ginawang paglapastangan nito sa punso dahil masamang magalit ang mga lamang-lupa.

22. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

23. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

24. Mula pagkabata ay naging magkaibigan na si Lando at Maria.

25. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

26. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

27. Lulusog ka kung kakain ka ng maraming gulay.

28. They offer interest-free credit for the first six months.

29. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

30. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

31. Oy saan ka pupunta?! Bayad ka na!

32. Inalok ni Maria ng turon si Clara.

33. Kucing dapat dilatih untuk melakukan beberapa trik seperti menjulurkan tangan untuk berjabat tangan atau melompat melalui ring.

34.

35. Umiinom si Andy ng vitamins kaya ang katawan nito ay bihirang magkasakit.

36. Maraming uri ng mga punong-kahoy na maaaring gamitin sa paggawa ng mga gamit tulad ng upuan, mesa, at iba pa.

37. Lumipat si Carlos Yulo sa Japan upang mas mapalakas ang kanyang training sa gymnastics.

38. Nagdulot umano ng matinding trapiko ang biglaang pagkasira ng tulay.

39. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

40. Esta comida está bien condimentada, tiene un buen nivel de picante.

41. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

42. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

43. Kumaripas ng takbo ang aso nang makita ang paparating na sasakyan.

44. Pakilagay mo nga ang bulaklak sa mesa.

45. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

46. Eksport af forskning og udvikling er en vigtig del af den danske økonomi.

47. La seguridad y el bienestar de los agricultores y sus familias son importantes para garantizar un futuro sostenible para la agricultura.

48. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

49. Napakainit ng panahon kanina at biglaan kaming nagpasyang mag-swimming.

50. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

Similar Words

popularize

Recent Searches

popularfertilizerkonekmalumbaydisappointingatanresortdividesmaliliitpagepaghakbangbakuranuniquecryptocurrencybasahanmentalgitarapasancompleteamazonspreadcallingshouldincreaseryanbroadcastsniceregularmentecuriousnaiiritang2001uminomclientespeterlaki-lakicommissionsiempreagesmantikalinggongpagbabagong-anyoteamdyipvivagupitmallstsonggobagomalakiclientetanghalianlahatsuwailnagtutulungansatinpinakinggansasayawinpanitikan,procesotag-arawnaggingaudio-visuallybumabahaanimoyandamingletayawinabotsheyumabongalituntuninparusamakuhapodcasts,pakisabikambingracialtulangnanayforståtibignilolokoandresmadalingnapakabutiwaldomagpa-checkupagricultoresnaninirahannakakatawakinikitagayunpamannaglalatangnagpuyosmakalipasdahan-dahandekorasyonibinubulongnakaririmarimpamanhikanhinawakantravelnanlalamigkumalmakayabanganmahiyayakapinbabasahindoble-karafilipinasasamahanumagawumiimikdispositivoiniindamagdamaganpinigilangasolinamagbibiladhumalodagat-dagatannagniningningnagdalainagawnatinagmaghilamosmaghaponcompanyjingjinglumipadpumayagkanginaindustriyaumikot1970skindergartenkassingulangnasunogkilayadvancementrespektivenakisakaykauntilakadnaglulusakexigentede-latahanapinkatibayangkapwatanyagbinawianabigaeladvertisingduwendeninyongnilayuanbumangonidiomanilapitanadecuadonapasukobigyandisyembredumaanmagtipidnatapossumigawalaalapigingbecamemaingatmagdabinigaylumingonipaliwanagxixsearchclientsproductionmarunongremainbeginningspalaginaglakadnag-aaralsumusunoearnstillumingitipagamotsparklabanamongdinalawritwalcommunicationsburdencompartenenchanted