Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Limitations can be cultural or societal, such as gender roles or stereotypes.

2. Nationalism can be a source of conflict between different groups within a nation-state.

3. The elderly are at a higher risk of developing pneumonia.

4. Aksidente naming nabasag ang isang plato habang naglilinis ng kusina.

5. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

6. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

7. Hinawakan ko yun yung kamay niya tapos nag smile at nag nod.

8. The value of a true friend is immeasurable.

9. Humarap siya sa akin tapos nag smile.

10. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

11. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

12.

13. Bawal magtapon ng basura sa dagat dahil ito ay nakakasira sa buhay ng mga isda at iba pang karagatan.

14. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

15. Ang mga batas tungkol sa paggamit ng droga ay mahalaga upang maiwasan ang mga krimen na may kinalaman sa droga.

16. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

17. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

18. Papaano ho kung hindi siya?

19. Huwag kang maniwala dyan.

20. Omelettes are a popular choice for those following a low-carb or high-protein diet.

21. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

22. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

23. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

24. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

25. She has been teaching English for five years.

26. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

27. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

28. Maganda ang kulay ng langit sa dapit-hapon.

29. Akin na kamay mo.

30. Durante las vacaciones de otoño, visitamos viñedos para la vendimia.

31. Ano ba pinagsasabi mo?

32. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

33. Binigyan ng pangalan ng Apolinario Mabini ang isang bayan sa Batangas.

34. Napakaseloso mo naman.

35. Mathematics has a long history and has contributed to many important discoveries and inventions.

36. Yan ang panalangin ko.

37. Magsuot ka palagi ng facemask pag lalabas.

38. Ang pag-asa ay nagbibigay ng mga solusyon sa mga problema at hamon sa buhay na hindi magagawan ng paraan.

39. Dalam Islam, doa yang dilakukan secara berjamaah dapat meningkatkan kebersamaan dan kekuatan jamaah.

40.

41. Necesito ver a un médico. (I need to see a doctor.)

42. Imbes na gamitin ang pana para kay Psyche, ay pinabayaan niya lamang itong mamuhay ng normal at tumaliwas sa utos ng ina.

43. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

44. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

45. Walang puno ang hindi hitik sa bunga.

46. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

47. Palibhasa'y walang kalaro, ang mga hayop na lang ang ginawang libangan nito.

48. They have organized a charity event.

49. Makikiligo siya sa shower room ng gym.

50. Madaming squatter sa maynila.

Similar Words

popularize

Recent Searches

popularbecamehalikanorderinnakadapapakakatandaansequecommander-in-chiefbitawanumiilingmagsabihugismakahiramnitongrediguhitmangkukulamcrucialnakikini-kinitangunitsumusulatipagmalaakimakapangyarihannampinanawansilbinguuwiinulitsalarinmabilisnapapahintoanubayaninumintaga-lupangpinalutodustpannaiinisnapanoodganyansocialtonyganidbihasalungsodeffektivpaboritopinangaralanpamumuhaylaptopcallerfriesdevicesmagsalitamedievalniligawanmatulisumiiyakbutterflyhinanapsalapianywherebiggestbilibidalas-treshearmagkasakitdistanciarise1000nakalockhallnaglalababuung-buoikinakagalitbarrocolasmakikiraanginagawaanakagosdiwatasakinanitonangyariipipilitoutpostentercualquierkumakaincourtcongratsburmaakmabiocombustiblesnanahimikusuarioseniorbranchesmaihaharappresence,handaankatagangmarianakaupokusinerogagawinmangingisdanglaylaykailanmanbumigaypagtinginmeansconsumegermanyberkeleysurveyslovewalletvariousmagdaraosexhaustedpagpapakalatlastinginantaynalugmokmalamiginfusionesnapadaanpamilihanmadalingpasaheatesumakitnilalangmaintindihanpagdamiadvancedtumunogteachcontrolledmagdilimklasenglibregayunpamanpalangdisyemprepumupurimeriendapalancaitouminomhumarapkinalangkaytiemposracialotherspagkaimpaktobuhay2001frescopinalayaspagpanhikinsidentekinapanayampinipisilpaninigassingaporesumasayawyanngamanuelmangangalakallumitawsikoyaritalinomag-aamadiagnosesinfluencenananalongpadabogespecializadasspapinilingdidingdefinitivoneversizejosephmagkakagustomagnakawtamananlilimahidnakapagproposeenforcingnaliligokanserbosesrefers