Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

2. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

3. Natigilan siya. Tila nag-iisip kung anong gagawin.

4. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

5. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

6. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

7. Ok. Free ka ba after work? Favor lang sana please.

8. Sadyang mahirap ang pag-aaral ng calculus, ngunit sa tulong ng tamang libro, maari itong maging mas madali.

9. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

10. Hindi ako nakatulog sa eroplano.

11. Ang malambot na lilim ng ulap ay nagbigay ng kakaibang kulay sa silong ng buwan.

12. Dahil malilimutin ako, nakalimutan ko na naman ang pangalan ng bagong kaklase.

13. Dahil sa kahirapan natuto siyang magnakaw at mandukot

14. From there it spread to different other countries of the world

15. May I know your name for our records?

16. At isang araw nga, nagpasya sina Damaso at Magda na tumakas at mamuhay sa ibang lugar.

17. Namatay ang mga pananim at ang tanging natira ay ang mga lasong puno na hitik na hitik sa bunga.

18. Kawah Ijen di Jawa Timur adalah tempat wisata populer untuk melihat api biru yang terlihat di dalam kawah gunung berapi.

19. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

20. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

21. Naiinitan talaga ako, malamig ba labi mo?

22. I have a Beautiful British knight in shining skirt.

23. Uy, malapit na pala birthday mo!

24. Magkita tayo sa parking lot ng Luneta Park.

25. Isinawak niya ang kamay, pinagkiskis ang mga palad at pagkaraa'y naghilamos.

26. Kung sino ang maagap, siya ang magandang kinabukasan.

27. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

28. Ayaw mo ba? tanong niya sa malungkot na tono.

29. All these years, I have been grateful for the opportunities that have come my way.

30. Bumalik ako sa dakong huli para iwan ang aking cellphone na naiwan ko sa table.

31. No hay palabras suficientes para agradecer tu amor y apoyo.

32. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

33. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

34. The roads are flooded because it's been raining cats and dogs for hours now.

35. Matagal na kitang nakikitang namumulot ng mga kahoy sa gubat na ito.

36. Dedicated teachers inspire and empower their students to reach their full potential.

37. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

38. Limitations can be cultural or societal, such as gender roles or stereotypes.

39. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

40. Einstein was married twice and had three children.

41. Maraming mga taong nakakalimot sa kababawan ng kanilang sariling kalooban dahil sa pagsunod sa lipunan.

42. Sa aking opinyon, isa sa mga magagaling na mang-aawit sa Pilipinas ay si Bukas Palad.

43. They are not hiking in the mountains today.

44. I have been taking care of my sick friend for a week.

45. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

46. Effective communication and teamwork are important for a successful and productive work environment.

47. Birthday mo. huh? Pano niya nalaman birthday ko?

48. She wakes up early every morning to exercise because she believes the early bird gets the worm.

49. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

50. Actions speak louder than words

Similar Words

popularize

Recent Searches

ibinalitangpopularnaiinitanjenapongkatagalaninimbitaumalisinanganisinknagliliwanagdownnakapagngangalitapollomusmoserap1920stinderawaldopalayiiklinakasuotblusaprutasbestlalaboholmayabangtignanusedandnagsagawapamilyangipipilitnapakahabanasaktancompletingsusunduinwidejanenaligawmayocryptocurrencykwebanggatheringhangaringjokeritwalsalaringuhitpusanakapagtaposvehicleshmmmmnakasakitsofamaawaoperateresponsibleshocksumangelectioninisrefersmadulasvaccinesprosperginisingsorryaalisknowsgumandakaklasegearmagugustuhanexpertisewordalleenterkendibakehangganggatolmethodsrequireevolvememorymitigateinformedimpactedinterviewingusepeterformmainstreamde-latanalalaglagaudio-visuallyconnectionsinumanmabilistumambadthirdmaramotmakapasaalikabukinmagpaliwanaggagamitpaumanhinisinagotdealipongofteroqueawitanmatigaspakanta-kantangkuyakommunikerermahigitmakahingikenjireloself-defenselaki-lakititakainanpasliti-rechargedevelopednagkatinginaneverybroadcastinglisensyafollowingmakapangyarihangcrucialpagkatnakapasokmalusoglosstwotaleipapaputolnanaynagsuotnalasingginoongngipinnitoalituntuninkasoydalagaipinanganaknatatangingtradisyonhandrewwebsitemaghaponhongtumalonatinbumahadogwouldultimatelyspentpangnangflamencogumapangsinonggayasarisaringracialincreasedexplaintatawagmusicalarawrespektiveimportantesiyudadmagsasalitanakakatandanakuhanakaluhodbusinessesnandyansaglitmetronapakahangapakealamnangangalirangbaotypesparticipatingmakapaghilamosfilipina