Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1.

2. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

3. Napahinto siya sa pag lalakad tapos lumingon sa akin.

4. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

5. Nice meeting you po. automatic na sabi ko.

6. May basa ng dugo't lupa ang kanyang nguso.

7. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

8. The scientific method is used to test and refine theories through experimentation.

9. Nag-umpisa ang paligsahan.

10. Nagtaka ako kung bakit hindi pumasok ang guro sa klase ngayon.

11. Sa pagguhit, mahalaga ang tamang pagbigay ng shadows at highlights upang makalikha ng dimensyon sa isang drawing.

12. Aku rindu padamu. - I miss you.

13. Ang sundalo ay nangahas na tumayo sa gitna ng labanan upang iligtas ang isang sugatang kasama.

14. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

15. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

16. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

17. Bagay na bagay sayo ang suot mong damit.

18. Bukas ay pumunta daw po kayo sa school sabi ng aking teacher.

19. Umupo kaya kayong dalawa! sabi sa amin ni Kriska

20. Takot at kinakaliglig sa lamig ang Buto.

21. Hindi ko alam kung paano ito tingnan, kaya sa ganang iyo, ano ang tunay na halaga ng pera?

22. Jagiya? hinde parin siya umiimik, Ya Kenji.

23. May himig pangungutya ang tinig ng pulis.

24. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

25. Sa bawat desisyon na ating ginagawa, kailangan nating isaalang-alang ang bawat posibilidad, samakatuwid.

26. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

27. All these years, I have been learning to appreciate the present moment and not take life for granted.

28. Limiting the consumption of processed foods and added sugars can improve overall health.

29. Magaling maglaro ng chess si Joseph.

30. Sa mga panahong gusto kong mag-reflect, pinapakinggan ko ang mga kanta ng Bukas Palad.

31. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

32. May mga taong nakakaramdam ng kalungkutan at nangangailangan ng pagtitiyaga at pang-unawa kapag sila ay mangiyak-ngiyak.

33. Oo. Gusto ko na lang sana talaga makauwi. sagot ko.

34. Ang mga magulang niya ay pinagsisikapan ang magandang kinabukasan ng kanilang mga anak.

35. Tumagal ng ilang araw bago mawala ang pamamaga ng kanyang paa.

36. Ayaw mo pa ba? tanong niya na nagpakunot sa noo ko.

37. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

38. Tengo escalofríos. (I have chills.)

39. Nangahas ang bata na tawirin ang ilog kahit hindi marunong lumangoy.

40. Tinawag nya kaming hampaslupa.

41. He has been repairing the car for hours.

42. He gives his girlfriend flowers every month.

43. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

44. Investing refers to the process of allocating resources with the expectation of generating a profit.

45. Paano kung hindi maayos ang aircon?

46. Sino ang nagtitinda ng prutas?

47. It ain't over till the fat lady sings

48. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

49. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

50. Some fruits, such as strawberries and pineapples, are naturally sweet.

Similar Words

popularize

Recent Searches

pasaheroconsideredpopularkaparehapesosdatimayonagbabagapinamalagiunidospitumpongmakuhangyelobillgameinnovationhundredumagawkristomagisingnararapatsinumangumigtadsinongmaglaronatayodevicesikinatatakotpwestohatingitinagotumamismagsusunuranumiyakgenerationermodernmagisipdiagnosesmukhadisseiniwankangitanmagbigayanibontvspigingsakoplumutangkasingfuturenagpunta3hrssasapakintibigtumindigadvancementmagsisimulanapakalusogsolidifylumulusobaddingpromisecontinuecontentkirbyfuncionarnaggalanapapatingindinaladumilimfallamayroongpananakopnakataasricosearchpagnanasatoyspanonoodturonakukuhapasasaansyangmatataloyoutubeimikmetodermakapaniwalakabibistruggledisataraganoonmaglabaparkekinaitongganangnahulinanoodsangkapmarasiganiyanpalakanglalabamagpagupitpag-aapuhappalantandaannagandahannagpadalatitiraipagpalitlaroupangexcitede-booksmartialmakakatakasltonapilitanexecutivecitybagsakearnomelettepadalasumiimikmalapadlivemabihisannag-aalalangbundokmapangasawasiyangmaalogmaidproductionmagkaparehocommunicationscasesbansangspindleumiiyaktalentedvocalknightipinagbilingclientebuwayaechavepalayannaghinaladadteknologibituinnaiinggitprogresshoweveramendmentsemphasizedsourcesmanagermetodisklumakaslasingsarilingnamumulotablemanirahanorasmatamisinfusionesthreebasahinredigeringuniversitymagkaibangcoaching:nabuhaynutsvelfungerendechickenpoxuniquehusolegislationhumabolhearkagabiannavideonapalitangbiyasgayunmanfollowedkakuwentuhanmarilouhuertopagsisisidisyembrepostcard