Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Nagtatrabaho ako tuwing Martes.

2. Technology has also had a significant impact on the way we work

3. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

4. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

5. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

6. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

7. Nagsasagawa ako ng mga pagsisikap upang maging maganda ang impression ng aking nililigawan sa akin.

8. Up above the world so high,

9. Pinaghihiwa ko ang mga kamatis.

10. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

11. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

12. La música puede ser utilizada para fines políticos o sociales.

13. Accepting the job offer without reading the contract was a risky decision.

14. Dito ang mga lalaki at doon ang mga babae.

15. Saan-saan kayo lumibot sa Amerika?

16. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

17. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

18. Si Teacher Jena ay napakaganda.

19. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

20.

21. Wala na siguro sya, baka natulog na inantok na.

22. Ano bang pinagsasasabi mo jan Kuya?

23. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

24. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

25. Pinasalamatan nya ang kanyang mga naging guro.

26. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

27. Wag kana magselos, mahal naman kita eh.

28. Ipabibilanggo kita kapag di mo inilabas ang dinukot mo sa akin.

29. Kinuha naman nya yung isang bote dun sa lamesa kaso.

30. The weather is holding up, and so far so good.

31. Emphasis can be used to express emotion and convey meaning.

32. Mathematics can be used to optimize processes and improve efficiency.

33. El que busca, encuentra.

34. Nous allons faire une promenade dans le parc cet après-midi.

35. I finally quit smoking after 30 years - better late than never.

36. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

37. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

38. Habang tumatakbo siya, tila lalong palayo ang kanyang mga pangarap.

39. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

40. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

41. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

42. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

43. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

44. Magdamag na bukas ang ilaw sa kwarto.

45. Amazon has a reputation for being innovative and forward-thinking.

46. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

47. Gusto ko lumabas pero malakas pa ang ulan.

48. Nagbago nang lahat sa'yo oh.

49. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

50. The bride looked stunning in her wedding dress, truly a beautiful lady.

Similar Words

popularize

Recent Searches

populardissenamapeeppakelambranchmodernebitiwannangyarinanunuksonanlalamignakakainmagsugalconventionalhumalakhaknanghahapditerminotaksimakapalmagkaroonneedsmagpaliwanagpamanhikannagtungotobaccomang-aawitnalalamannangampanyarevolucionadokitangnag-uwisasamahanluluwasnagpabayadbestfriendsubalitspentfederalismagricultoresmarurumiginawaranlumutangpabulongmabatongtig-bebeintebinge-watchingseryosongcanteengumulongmenssugatangnakisakaynasunogmasukoltibokkauntibanktagaytaynaisrestawranbinibilirolandcalciumreportspaidea:tekstoperatebutilpasokcrameamongpageritwalotrasnamulaklakmalakingworkdayeveryhalagabaldelalamunanipinalutoelectednutssummitnotebookkakaibaprocessyeahalexanderbilhinwasakipinadalananalostoretopic,hinanaplawabaduybumisitatransportaplicarwellharipaaralanpinakamalapitoutlinesmagsi-skiingeroplanodisensyopowerpointmagkakaroonglobalisasyonwaitersikonagdadasalkapataganvidenskabkotsedasalpag-aagwadorpresidentenakonsiyensyamasakitsumayawnagtitinginanfilipinofamecardiganpinabulaantuktokdingdingguitarraunossiguroiniskakilalamapakalistevepisifacilitatingbornsariwapisopneumoniaagilamaya-mayasasapakinpakistanmanakboaniyaeksamcalambabumabacompostelarelohinagpiscarepoolbigyankinawaringpagbabagong-anyokinatatalungkuangnagtatrabahohindikaninumannakakapasoktinatawagsaranggolanakapangasawaikinabubuhaymagkaibamagpapabunotmagtanghaliannanghihinatinaasannagtrabahokalaunanmakakakaenpakikipagbabagnagsasagotkapasyahanmahabapagkaawapananglawmagtatanimilalagaypagtatanimmaglaroharapantaximagsunogedukasyonnararamdamankuwartosementongnagyayangbahagya