Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. When in Rome, do as the Romans do.

2. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

3. Basketball is a team sport that originated in the United States in the late 1800s.

4. Ang mga nangunguna sa industriya ay kadalasang itinuturing bilang mga eksperto at mga awtoridad sa kanilang larangan.

5. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

6. Hindi ko mapigilan ang aking mga titig sa aking nililigawan dahil sobrang ganda niya.

7. Napakalaki pala ng agila sa malapitan!

8. Lumiit ito at nagkaroon ng mga mahahabang paa.

9. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

10. The cake was so light and fluffy; it practically melted in my mouth.

11. Ito lang naman ang mga nakalagay sa listahan:

12. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

13. El error en la presentación está llamando la atención del público.

14. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

15. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

16. It's time to pull yourself together and start making positive changes in your life.

17. Gumamit si Mario ng matibay na tali para sa kanyang saranggola.

18. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

19. She does not smoke cigarettes.

20. Sariling pagraranas ang aking pamamagitan.

21. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

22. Muntikan na syang mapahamak.

23. Pupunta ako sa Madrid sa tag-araw.

24. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

25. Padabog akong umupo habang dumadating na yung order nya.

26. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

27. Hindi ako sang-ayon sa mga patakaran na ipinatutupad ng gobyerno.

28. Le jeu peut avoir des conséquences négatives sur la santé mentale et physique d'une personne, ainsi que sur ses relations et sa situation financière.

29. Tuwa at sigla ang dala ng saranggola sa bawat bata.

30. Maglalakad ako papuntang opisina.

31. Sa pagguhit, mahalaga ang tamang pagkakabalangkas ng mga elemento.

32. He has traveled to many countries.

33. Sa tabi ng aming bahay, ako ay nagtatanim ng mga herbs at spices.

34. Saglit lang lang naging kami. Sabi niya sa akin..

35. Pinapairal ko ang aking positibong pananaw sa buhay upang hindi ako magkaroon ng agam-agam.

36. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

37. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

38. Sa dakong huli ng deadline, nai-submit ko na rin ang aking project.

39. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

40. Wala akong pakelam! Dapat sayo pinapalo!

41. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

42. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

43. Babalik ako sa susunod na taon.

44. Anong kulay ang gusto ni Elena?

45. The conference brings together a variety of professionals from different industries.

46. Mas malaki ang huli, mas marami rin ang panindang maipapautang sa iyo ng ngingisi-ngising negosyante.

47. Ang pagtulong at pagtutulungan ng mga komunidad ay mahalaga upang masiguro ang kaligtasan at pag-angat mula sa pinsala ng buhawi.

48. Many people go to Boracay in the summer.

49. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

50. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

Similar Words

popularize

Recent Searches

popularfitsumindicryptocurrencyboksingbumahaipapaputolsinongtiyakanrosedurigranmatindingtrueidea:kingsorrydinibalediktoryansyasinumankapeteryaitemssasagutinwebsitenasanlibagpointcandidatemensajessaritabiologiinferioresnanahimikkinabubuhaykapatawarankinikilalangnakalilipaskalayaannagandahannakapagsabinagtutulaknapatawagpakanta-kantangmagkakagustonakikilalangnakakatulongpinagtagpoattorneypagtangisstatesmasayang-masayapaumanhintransportnapakamotumiinompakakasalansiguradogatolscottishlalabhanpapalapitusuariomahabangmetodiskpinipilithinilanangingilidnumberhotelexpresanganunmahahabangbundokestablishsipagseniorearnnapakagandakamatisisinagotasullatetalagaaddresspumuntajohncommunicatenagtatrabahodiyankadalagahangrightpinag-usapanmaipantawid-gutommakakatakasdecreasedisyembrehumalakhakcualquieragwadornakapangasawanagpapakainimpenmakakasahodvideos,sayawanagadanungnangampanyanagre-reviewpalakamovinggagamitinsuwailbecomingemphasistiketcoincidencesongspagngitiinantokmatutuloglumutangpanggatongconventionalpetsapakaindesign,lalargaexperts,dissealambetapag-alagaedukasyonbinasanagtitinginanheartbeatpaderaalisrestaurantcoaching:servicespulubibienfotoskelanganartistasfacilitatingmakikipagbabagtumawagnamulaklakkikitanakapagreklamopaghalakhaknananaloteachingsnakakapasokpamilyangbumibitiwpanghihiyanghitsurabuung-buonagpabayadkuryentemaghahatidumuwikumakainhunimini-helicoptermainitnaliligomagkasabayjuanrichcollectionsbasketbolgulangprocessmanuksoeffectdaymakakawawahjemstednapapalibutansenadordreamkanluranpinagalitanmagpagalingyumaocynthianagmadalinghoneymoonkainanbanlagvaccinesnatalopangunan