Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Lumingon ako para harapin si Kenji.

2. Hindi na sila nasisiyahan sa nagiging asal ng bata.

3. Sa kabilang silid, nagitla ako nang biglang sumigaw ang aking kaibigan.

4. Keep practicing and hang in there - you'll get better at it.

5. Maarte siya sa kanyang hitsura kaya lagi siyang nakabihis ng maganda.

6. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

7. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

8. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

9. Pwede mo ba akong tulungan?

10. Gusto mo bang maglaro ng basketbol?

11. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

12. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

13. Mathematics can be used to model real-world situations and make predictions.

14. Magkano ang isang kilo ng mangga?

15. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

16. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

17. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

18. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

19. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

20. Emphasis is often used in advertising and marketing to draw attention to products or services.

21. Kayo din po ba ang nagpapakain sa kanya?

22. The package's hefty weight required additional postage for shipping.

23. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

24. Gumawa ako ng cake para kay Kit.

25. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

26. Nag-aral ako sa library kaninang hapon.

27. Bago niya napanalunan ang ginto, si Hidilyn Diaz ay nagwagi na ng pilak na medalya sa Rio Olympics 2016.

28. The scientist conducted a series of experiments to test her hypothesis.

29. Dahil sa iyong pagiging labis na madamot, kahit na marami ka namang pananim na maaring ibahagi sa iyong kapwa, ikaw ay aking paparusahan.

30. They knew it was risky to trust a stranger with their secrets.

31. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

32. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

33. Budgeting, saving, and investing are important aspects of money management.

34. The wedding reception is a celebration that usually follows the wedding ceremony.

35. Hindi niya tinapos ang kanyang proyekto sa tamang oras, samakatuwid, hindi siya nakasali sa kompetisyon.

36. Nous avons réservé une salle de réception pour la célébration.

37. A bird in the hand is worth two in the bush

38. Ilang tao ang pumunta sa libing?

39. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

40. Pemerintah Indonesia menghargai dan mendorong toleransi antaragama, mengedepankan nilai-nilai kehidupan harmoni dan persatuan.

41. Saan naman? nagtatakang tanong ko.

42. Over-emphasis can be counterproductive and may undermine the intended message.

43. Gracias por ser una inspiración para mí.

44. Nakakatuwang malaman na maraming kabataan pa rin ang nakikinig at nakakatuklas ng kagandahan ng mga kanta ng Bukas Palad.

45. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

46. Nous avons renouvelé nos vœux de mariage à notre anniversaire de mariage.

47. Palibhasa ay may kakayahang magpahayag ng kanyang mga kaisipan nang malinaw at mabisa.

48. Huh? Anong wala pa? nagtatakang tanong ko.

49. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

50. Pakibigay na lang sa punong-guro ang liham ng mga magulang mo.

Similar Words

popularize

Recent Searches

ilawpopularhigh-definitionpongrosellehumigasumasakitjenapasensyaedsasaradissecompositoresfitbalatklasengkontingvivacarloorganizekarganginfluencesmakinangtibokmayabongtulangtugondespues1960ssisipainhimayinawardcalidadipagmalaakimininimizemakagawasinimulandyipindiagranadacassandranagdarasalfauxipantalopbinasamansanasmukasumagotdogssupilinopomaskimarteschoiblusanatandaanhmmmbagamatkalakihanbriefestablishjokedettecongresstelangkabibibusyangprimerterminoexcusesweetclaseshangaringreserveswordmarioespigasfuelguhitencompassestaingaseriouspopularizemahahabaitinago11pmmerrymaisgivearbejderwaribiglamapaibabawtransmitskapetillgrammarblusangadangsnasolarferrerbeeneducationalfatalcalldollarmetodeeksaytedmapadaliteamdumatingfistsspeedtuwidtwinklestatusstudentcomeshockkumarimotbelievedtransitbilisdontitinalicompartenmalinisrobotictennagreplylatestpinalutobilhinspecialcommissioncomienzanveryredesleukemiahinabanilinislegendsharingshiftcomputercomplexincludegitarahateneedsbehaviorwindowformsflashcompleteexplainberkeleytwopublishedcableipinalutoviewbasaelectedstopknowmenucommercegoingextraprovidedinteriorthoughtsonlytiyasquatteritlogdoscomputereflyactiondoonnothingcleancakeipapahingahimutokpagnagdaramdamhumihingimonghumarapadvertising,baoendviderenagsisilbikagalakanmallopdelt