Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Tinapos ko ang isang season sa netflix kaya napuyat ako.

2. Oh gosh, you're such an ambisyosang frog!

3. Sayang, kenapa kamu sedih? (Darling, why are you sad?)

4. Wives can be loving, supportive, and caring companions to their spouses.

5. Uno de mis pasatiempos favoritos es leer novelas de misterio.

6. Binigyan niya ng kendi ang bata.

7. Sa dakong huli ng deadline, nai-submit ko na rin ang aking project.

8. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

9. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

10. Sa mapa, makikita mo ang mga pook na may magandang tanawin.

11. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

12. Marahil ay hindi magandang ideya na maglakad mag-isa sa madaling araw.

13. Hubad-baro at ngumingisi.

14. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

15. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

16. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

17. Mayroon akong asawa at dalawang anak.

18. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

19. La creatividad es clave para el éxito en el mundo del arte y el diseño.

20. ¿Te gusta la comida picante o prefieres algo más suave?

21. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

22. They are not cleaning their house this week.

23. Siya si Helena, nag-iisang anak siya nina Haring Bernardo at Reyna Lorena.

24. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

25. Mabait ang mga kapitbahay niya.

26. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

27. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

28. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

29. Sorry, I didn't catch your name. May I know it again?

30. Mainit sa Pilipinas sa buwan ng Abril.

31. Gaano karami ang dala mong mangga?

32. Mahal na mahal kita.. wag mo muna akong iwanan, please.

33. A mi esposa le encanta hacer manualidades como pasatiempo.

34. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

35. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

36. Nagtatrabaho ako sa Student Center.

37. Ang pagtulong sa iba ay isang halimbawa ng kabutihang-loob na pinagsisikapan ng marami na isabuhay araw-araw.

38. Marahil ay nasa kabilang dako ng mundo ang taong mahal mo kaya't hindi kayo nagkikita.

39. Ginaganap ang linggo ng wika ng Agosto.

40. Hindi minabuti ni Ogor ang kanyang pagsigaw.

41. Ano ang gagawin ni Trina sa Disyembre?

42. Mag-babait na po siya.

43. The feeling of falling in love can be euphoric and overwhelming.

44. Hindi ninyo madadala sa hukay ang yaman ninyo.

45. Los médicos y enfermeras estarán presentes durante el parto para ayudar a la madre y al bebé a pasar por el proceso.

46. Nasi kuning adalah nasi kuning yang biasa disajikan pada acara-acara tertentu dan dihidangkan dengan berbagai lauk.

47. La tormenta produjo daños significativos en la infraestructura de la ciudad.

48. Ang sabi naman ni Bereti ay naiinggit kay Karing dahil marami itong bagay na nararanasan na hindi niya nararanasan.

49. Maramot ang bata sa laruan kaya walang gustong makipaglaro sa kanya.

50. She has been cooking dinner for two hours.

Similar Words

popularize

Recent Searches

populartalentmalihiswasakinihandakaugnayankarangalankahusayaninvitationanak-mahirapiniinomnapatingalabinulongiiklianaybevaregranadalaybraritshirtbangwordtuwangipinadalasilbingbranchlapitanmaarihehesongssinumankaninumantools,tanimconectadostraffic1980comienzandalawsaanhangaringtamisfuncionesyoungspamuliagoslatesoonmatindingmatangimpactedgenerabaplatformswaysipapainitagemakilingvasquesstudentdiyanneedsnapakacontroladependingvandifferentmitigateinfinitystep-by-stepdiniculturathankjohnhouseholdsalaypasigawkayakagandapaalamnatutuwabalitanagkakatipun-tiponisdangnapakatalinomaihaharapfuetupelopaghahabinanamanipinabalikmaibasamakatwidsorrymahigitbalangkaragatansasamapusomestnootodoterminoshapingmovinglakasnagaganapmind:affectskyldes,magsunogbowlnaghihirapnaiisippawiinnareklamoyumuyukomagbagong-anyopagkakapagsalitakamieffectromerotalinotemparaturaestudiotiktok,bisitapagmamanehopagsisisinagmistulangnagkalapittinutopmagpapabunotnapakahusaynakaluhodressourcernemang-aawitnakakapasokobra-maestratinaasaninformationroonkampokinabubuhaynagsagawabinibiyayaandahan-dahanmahihirappagpapasankarwahengperpektingkakilalasay,makaiponuniversityfranciscomiyerkulesprincipalesnationalnakauslinglumindolpahabollansanganpundidotumaposminatamisvarioussettamarawkamalianrewardingnaantigpinipilitbusiness:magkabilangmandirigmangtransportestadoscrecersakyannagwikangpumikitpabilidialledbaguioanilanaiwangkaybilishatinggabilaganapnakabiladtelalipatinintaysmilelasahabitdisenyomaghintaytiyanentertainment