Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Anong panghimagas ang gusto nila?

2. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

3. Pinaluto ko ang adobo sa nanay ko.

4. Ito ay alay nila bilang pasasalamat kay Bathala.

5. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

6. Ngunit naglahong parang bula si Pinang.

7. She has been teaching English for five years.

8. Sa panahon ng pandemya, mas marami ang nangangailangan ng bukas palad na pagtulong mula sa atin.

9. Hindi ako nakatulog sa eroplano.

10. This can be a great way to leverage your skills and turn your passion into a full-time income

11. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

12. Many financial institutions, hedge funds, and individual investors trade in the stock market.

13. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

14. They have sold their house.

15. The telephone has undergone many changes and improvements since its invention

16. Bayaan mo na nga sila.

17. Controla las plagas y enfermedades

18. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

19. Magsusunuran nang manukso ang iba pang agwador.

20. Después de leer el libro, escribí una reseña en línea.

21. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

22. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

23. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

24. Kailangan natin ng mga kubyertos para makakain ng maayos.

25. Ikinakagalit ko ang mga sakim na minahan.

26. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

27. Ang mga bayani ay nagtutulungan upang maipagtanggol ang bayan laban sa mga banta at kahirapan.

28. Starting a business during an economic downturn is often seen as risky.

29. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

30. Tumindig ang pulis.

31. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

32. Ang salitang "laganap" ay nangangahulugang malawakang kumakalat, umiiral nang malawakan

33. The cake was a hit at the party, and everyone asked for the recipe.

34. Ang pagtulog ay isang likas na gawain na kinakailangan ng bawat tao para sa kanilang kalusugan.

35. Ano ang paborito mong pagkain?

36. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

37. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

38. I woke up early to call my mom and wish her a happy birthday.

39. Me encanta el aroma fresco de las hierbas recién cortadas.

40. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

41. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

42. Palibhasa ay mahilig siyang magbasa, kaya marami siyang nalalaman sa iba't-ibang paksa.

43.

44. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

45. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

46. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

47. Nakasuot siya ng pulang damit.

48. Sino ang pupunta sa bahay ni Marilou?

49. Ofte bliver helte hyldet efter deres død.

50. Ang manunulat ay nagsusulat ng nobela na nagpapakita ng kaniyang malikhain na imahinasyon.

Similar Words

popularize

Recent Searches

popularartistskombinationkindspitumpongnatalonginihandanahihilosacrificematigaskatapatnapag-alamanmagpasalamatsquashsalesbarrocobuslofurtaassinkbalancesdaladaladipangamopetsangredesaseaniniresetaoutlinespare-parehosumabogpshmalagolaborsinlamanfueliskobecomeusalordmakipag-barkadamatatalimkuryentemuchaselectionsmarchadverselymaaringpitakatrafficsparkpersonalmasayahydelisugasigningslayout,sulingantargetcontinuespinunitharmfulbubongtekstoutpostoperateintramurosgrabenariningtimenatingnerissaimpitfigureevenplatformsbroadbaldeinteractalakdalasimplengprogressuloevolvedgeneratedlasingbackmenuclassmatenotebookknowmagkasamangpangkaraniwansouthmatutongbulakpaghabautak-biyatiningnanitinulossiyangtulisang-dagatgandanalangconvertidasubotig-bebeintekwebangnakakunot-noonglarrybasahanminutenakaliliyongoktubreformlaki-lakisaan-saanpagbabagong-anyonamumulaklakfredrefdadalawinpanghihiyangpagtataposmonsignorkagandahanreaksiyonnagandahanmerlindakapangyarihangkasaganaanmakikipaglarokaaya-ayangnakapapasongmagpa-checkupnovellesnauliniganibinibigaynagmistulanghahatolaraw-arawkulungangasolinakamiasgovernmentnagwagihjemstedreallyfranciscoiiwasannakatuonmahirapsasakaynakataaspaglulutopwestosamantalanghinanakitculturessalaminsinehanpagsayadconclusion,kilayilanpanunuksokuligligniyonpapalapitmahahawasulataregladorepublicanrobinhoodtanawbawatkatolikoemocionalmaghahandanaalisaguaparoroonagulangbutihumpaymagsi-skiingfatherambagmangingibigpublishing,hinabolsapilitanghastahmmmibinalitangparkepaksadisyembre