Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Emphasis can be used to persuade and influence others.

2. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

3. She has been cooking dinner for two hours.

4. Ang tagtuyot ay nagdulot ng malawakang pagkamatay ng mga alagang hayop.

5. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

6. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

7. Sa ganang iyo, dapat pa bang bigyan ng pangalawang pagkakataon ang mga nagkasala?

8. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

9. Sa bahay ni Pina ang salu-salo.

10. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

11. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

12. Nahulog ang bola sa kanal kaya’t hindi na nila ito nakuha.

13. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

14. Madulas ang magnanakaw, ngunit nahuli rin siya ng mga naglalakad na sibilyan.

15. That'll be 4,788.50 pesos ma'am.

16. Inihayag ng mga empleyado ang kanilang mga mungkahi upang mapabuti ang mga proseso sa opisina.

17. Ang daming bawal sa mundo.

18. La música también es una parte importante de la educación en España

19. Araw- araw nangangahoy si Mang Kandoy sa kagubatan para gawing uling.

20. Saan pupunta si Trina sa Oktubre?

21. Maiba ako Ikaw, saan ka magpa-Pasko?

22. Hendes skønhed er betagende. (Her beauty is mesmerizing.)

23. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

24. Le musée d'Orsay est un incontournable pour les amateurs d'art.

25. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

26. Nanlalamig, nanginginig na ako.

27. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

28. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

29. Bumili sila ng bagong laptop.

30. Sandali na lang.

31. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

32. Pumasok sa sinehan ang mga manonood nang limahan.

33. Binibigyan niya ng halaga ang bawat oras na pinagsisikapan niya upang maging mabuting ina.

34.

35. Sa dakong huli ng aking buhay, sana ay masabi ko na nagawa ko ang lahat ng gusto kong gawin.

36. Det er vigtigt at give børn en kærlig og støttende opvækst.

37. A couple of books on the shelf caught my eye.

38. El arte callejero es una forma popular de arte urbano.

39. Bilang paglilinaw, ang sinabi kong oras ng meeting ay alas-dos ng hapon, hindi alas-tres.

40. ¡Buenas noches!

41. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

42. Nagliliyab ang mga damdamin ng mga tao habang sila ay nagpoprotesta sa kalsada.

43. Natayo ang bahay noong 1980.

44. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

45. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

46. Ang dating kawawang usa a naging isang napakagandang diwata subalit hindi na rin natago ang mga sugat nito.

47. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

48. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

49. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

50. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

Similar Words

popularize

Recent Searches

meanspadabogvistilocospopularfresconag-replymakahingikelanbumigaymataposlegacydumaanpong1950skaarawanhappenedmarmaingplasaallottedsinunodrabewaybrindarmadamiilog1876animoydiamondbecomepitocupidkapeexcuseconsisttransmitsmediacarepangitsigenapatingalasantowarionlinedipanghmmmmmadurasbiglacitizenupangsinampalxixbilaowalanoblescottishpaghingisinkcelularesgrammartanodinomsigasoccerhispostcardklasrumsakinkabibisinipangbosscongressbusyangpakainipanlinismedievalstillshowsdollybagoeffortsbinibinigisingcollectionsbarnesnatanggapindividualnyagamottoothbrushbatocompostelabisigpolosuffermabilisasullordroomhangaringstaplelayasspentsukatginangclaseslamangelitepinyapropensoreaderstryghedlimosprocesoleukemiawatchingpedromalasfakevampiressumasambasorebasahanpitakaatinfuryshortklimaolivialeytesubjectmisuseddisappointsumamabatiredesmalagonagbungatenderverybataydalandanpinalutocommissionmaitimhigitaftercryptocurrency:katabingpshcardscientificpootlegendssumabogmightritwalimportantesmurangitak10thelectionsouebinabaliktomaragapagepumuntamatangrestawanadditionboteuncheckedmemorialwordsnatingalareducedabeneaaliscallerboyetfrapagbahingstarbokparaguardabinigyangsobratanimtraffictools,sumindibienlatestnitongwidefireworksboksingfertilizer