Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Don't waste your money on that souvenir, they're a dime a dozen in the market.

2. Nagpaluto ang nanay ko ng adobo sa akin.

3. I absolutely love spending time with my family.

4. Aray! Hinde ko naintindihan yung sinabi mo!

5. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

6. Dadalo si Trina sa workshop sa Oktubre

7. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

8. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

9. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

10. Padalas nang padalas ang mga nawawala kaya't lumapit ang taong bayan sa kanilang makisig na hari upang humingi ng tulong.

11. May gusto ka bang gawin mamayang gabi?

12. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

13. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

14. Ang paggamit ng droga ay maaaring magdulot ng pagkawala ng trabaho, pamilya, at mga kaibigan dahil sa mga problemang may kinalaman sa droga.

15. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

16. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

17. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

18. Wer nicht wagt, der nicht gewinnt.

19. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

20. Maingat na nangampanya ang mga kandidato ayon na rin sa alituntunin ng IATF.

21. Binisita ako ng aking kaibigan na matagal ko nang hindi nakita kaya masayang-masaya ako ngayon.

22. Modern civilization is based upon the use of machines

23. Ano ang suot ng mga estudyante?

24. It's wise to compare different credit card options before choosing one.

25. Hindi dapat umutang nang labis sa kakayahan ng pagbabayad upang maiwasan ang pagkakaroon ng financial burden.

26. Storm can control the weather, summoning lightning and creating powerful storms.

27. Aquaman has superhuman strength and the ability to communicate with marine life.

28. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

29. Tengo náuseas. (I feel nauseous.)

30. La música clásica tiene una belleza sublime que trasciende el tiempo.

31. Kaano-ano mo si Juan Dela Cruz?

32. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao.

33. Ang bawat gabi, ang aming katiwala ay nagiigib ng tubig mula sa poso upang punuin ang tangke ng bahay.

34. Sandali na lang.

35. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

36. Siya ang aking kaulayaw sa lahat ng aking mga pangarap.

37. Makikita ko ang mga kapatid ko sa pasko.

38. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

39.

40. Ang arte. bulong ko sa may batok niya.

41. Si Datu Duri ay matandang-matanda na.

42. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

43. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

44. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

45. Comer regularmente comidas pequeñas y saludables durante todo el día puede ayudar a mantener niveles de energía estables.

46. Nasa Massachusetts ang Stoneham.

47. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

48. Pagdukwang niya ay tuloy-tuloy siyang nahulog sa ilog.

49. Mababa ang marka niya sa pagsusulit dahil hindi siya nakapag-aral.

50. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

Similar Words

popularize

Recent Searches

utilizarpopulartugondomingokombinationnami-misstalentedpocasinunodasulkamatisteamresponsibleilanharmfulcondoditomaaringrichriskvotestabihankinausapbooksagingintramurosdagatpresencesenadorweddingnapagtantotatlonguncheckedselapaanansikrer,suotpistamasaganangmanagerclientekastilaimpitnakakasamamagkaparehomanlalakbayikinagagalakkakuwentuhangitaradiningestudyanteamerikatahanannamingpakibigayhidingagam-agamtiktok,namumulotmagsusunurankelanganpagtatanimmahiwagamahinangsinasabisistemasnasasalinankulunganprodujoinatupagperpektingtilgangautomatiskmaabutanpagbahing1940kabinataanpapalapitlabiscultureslever,hagdananprincipalespamagatsay,nagdabogsampungbarreraseksport,hinamakpaalamlilikosongsbumagsakmassachusettspesosnakanakainkumapitmariloubibilinababalotbayangliv,diseasesmagnifynasuklammaramiinintaypulitikocornersmightadditionblueburgerpinakamahalagangmaidinantaypuedenkatagapusapigingroleimproveallowssupportmoneysaan-saanngunitnakasakit1000grewsweetbio-gas-developingpeacebeginningsuripalayanwatchproblemanakikilalangkidlatlilimnanamancruzindustriyakakahuyanconductmegetwakasbarnessinungalingbagkusgabrielrangedancepuwedenghumihingiestablishumiilingkabiyakparangworldkalaunanlinggolinggo-linggoconsidereddalhanpinagwagihangmunaluhapinakamalapitservicesmelissamataraykasapirinantoklazadahimayinpaldagrowthguromulti-billionhomeworkinumininalalayanscienceyumabongmakakakaengumagalaw-galawnapakamisteryosomagagandangkaloobangmakahirampresidentialpamburapinagsikapankinamumuhianpagpilierlinda