Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Pumunta sila dito noong bakasyon.

2. Ang pagkakaroon ng magandang asal at ugali ay mahalaga sa bawat relasyon, samakatuwid.

3. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

4. Ano ang ipinabalik mo sa waiter?

5. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

6. Ang pagkakaroon ng maayos na usapan ay nagpawi ng mga alinlangan sa pagitan naming mag-asawa.

7. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

8. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

9. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

10. Patunayan mo na hindi ka magiging perwisyo sa kanila.

11. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

12. Eh bakit nakalock ha?!!! Explain mo nga!

13. Nagkagulo sa palengke at kumaripas ng takbo ang mga tao dahil sa maling akalang may sunog.

14. Bakit ka tumakbo papunta dito?

15. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

16. The store has a variety of sizes available, from small to extra-large.

17. Starting a business during an economic downturn is often seen as risky.

18. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

19. El cilantro es una hierba muy aromática que se utiliza en platos de la cocina mexicana.

20. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

21. Gusto po ba ninyong lumipat sa ibang kuwarto?

22. Lazada is an e-commerce platform that operates in Southeast Asia.

23. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

24. Sa gitna ng kagubatan, may matatagpuan kaagad na malalaking punong-kahoy.

25. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

26. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

27. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

28. The beauty store has a variety of skincare products, from cleansers to moisturizers.

29. Mayaman ang amo ni Lando.

30. Ang kamatis ay mayaman din sa vitamin C.

31. Itinago ko ang mga sulat para sa inyo.

32. Cooking at home with fresh ingredients is an easy way to eat more healthily.

33. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

34. Lazada has a reputation for offering competitive prices and discounts.

35. Supporting policies that promote environmental protection can help create a more sustainable future.

36. Kung hindi naman ninyo kaya ay sabihin ninyo at tatawag ako ng ibang pulis.

37. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

38. El movimiento del baile contemporáneo tiene una elegancia sublime que conmueve al espectador.

39. Umayos naman ako ng higa at yumakap patalikod sa kanya.

40. Kahit bata pa man.

41. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

42. Agad na natuyo ang dugo hanggang sa naging abo ito at humalo sa lupa.

43. The dog barks at the mailman.

44. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

45. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

46. Magandang Umaga!

47. Nous allons faire une promenade dans le parc cet après-midi.

48. Det har også ændret måden, vi interagerer med teknologi

49. May himig pangungutya ang tinig ng pulis.

50. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

Similar Words

popularize

Recent Searches

populararmedipag-alalaanyokampeonsinikappagkakalutopackagingfredengkantadangradyoparolnagbungapakipuntahanmaligoindenpigilanwifinageenglishduonnagliliyabbalik-tanawatensyonpisingnakangitingnatingnakangisinglinawmagalanghawlaincreasinglymagsuotdadalawinmakasahodpinangaralangsakalingnagkalatpagpapasakittiniradorbahalailancontinuesgreatnagdadasalyumakapemnernagsasanggangdullprotestameetestadoslastingpulangpanalopasensyapaospasensiyamagpalagosapotawitdedicationmatapobrengbridehojasninyongpagtitiponcorrientespaghuhugastatanggapin1940prinsesafreenaiwangbilanguntimelypapelkahusayanmasukoliba-ibangsequesinakopphilippinebangkalumalangoysquatterkumbentowalkie-talkiematarayhetopagkaimpaktobahagyaimbesminutenakukuhapaglalayagkaklasemalayarememberngunitmisasumusulatauthormatabangkasamaelepantekalikasanbastanakatitigadditionallysupportcakeindustrytheremag-ingatpresentahontigilyumaonag-aagawananukisapmatasuriinbaranggaypinggannakakamanghamakasakaytumahimikopgaver,feelingalaalainterestsaritaillegalmagulangnagbigayanmbalokasawiang-paladtuluyanmicasinumandaladalatinigmagbabakasyonaniyamahinananakawanpasalamatannakasabitpagsahodestasyonverden,downnaalalaforskel,borgerecontroversypinagawamessagekaysarapitutuksohigamaputulannapakasipagnagwikangmag-galaninongbaulspeciallargerdangeroustinutoptreatshinamakrightpinyuankababayangmaskinerhanapinkatotohanandiyanfe-facebookgawaingideyaulinglivedivisionlenddumilatpinabulaanakokulturganastartedkusinapaki-translateginalilydyipumiilingpulgada