Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

2. Hay muchos géneros de música, como el rock, el pop, el jazz y el clásico.

3. Ang panaghoy ng mga manggagawa ay umalingawngaw sa buong pabrika.

4. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

5. Ang panitikan ay may kakayahan na magbukas ng ating isipan sa iba't ibang kaisipan at ideya.

6. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

7. Ang sugal ay isang problema ng lipunan na dapat labanan at maipagbawal para sa kapakanan ng mga tao.

8. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

9. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

10. For eksempel kan vi nu tale med vores enheder og få dem til at udføre opgaver for os

11. This has led to increased trade and commerce, as well as greater mobility for individuals

12. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

13. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

14. Gusto ko sana na malaman mo na pwede ba kitang mahalin?

15. Madulas ang magnanakaw, ngunit nahuli rin siya ng mga naglalakad na sibilyan.

16. Kailangan ko umakyat sa room ko.

17. Mula nuon, sa gubat namuhay ang mga matsing.

18. Ginising ko si Cross, Oy gising. Umaga na.

19. El perro de mi amigo es muy juguetón y siempre me hace reír.

20. Pinagsulat si Jayson ng pangungusap sa pisara.

21. Ilan ang tao sa silid-aralan?

22. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

23. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

24. Las redes sociales pueden ser un lugar para descubrir nuevos productos y tendencias.

25. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

26. The stuntman performed a risky jump from one building to another.

27. Busy pa ako sa pag-aaral.

28. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

29. Sa pag-aalala pala sa kapatid ay sumunod si Perla at kitang-kita niya nang mahulog siya sa ilog.

30. If you quit your job in anger, you might burn bridges with your employer and coworkers.

31. Bigla ang pagbabago ng anyo ni Magda at Damaso.

32. Hun er utrolig smuk. (She is incredibly beautiful.)

33. Durante el invierno, se pueden ver las auroras boreales en algunas partes del mundo.

34. Nag-iisa kasing anak si Ranay.

35. They go to the movie theater on weekends.

36. Si Gng. Cruz ay isang guro sa asignaturang Filipino.

37. Kaninang umaga ay bumigay na ng tuluyan ang kanyang katawan, wala ng nagawa ang mga doktor.

38. Pakilagay mo nga ang bulaklak sa mesa.

39. Bawat umaga, ako'y bumabangong maaga para maglakad sa dalampasigan ng karagatan.

40. A quien madruga, Dios le ayuda. - The early bird catches the worm.

41. Hindi ako pumapayag sa kanilang plano dahil nakikita kong mayroong mga posibleng panganib na maaring maganap.

42. Pinilit nyang makipagtagisan sa abot ng kanyang makakaya.

43. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

44. Ang panaghoy ng kanilang awit ay nagbigay-inspirasyon sa mga tagapakinig.

45. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

46. Binigyan niya ng kendi ang bata.

47. Ang paghahanap ng katarungan at pagkamit ng hustisya ay nagpapawi ng galit at pagkadismaya.

48. All these years, I have been blessed with experiences that have shaped me into the person I am today.

49. Baka puwedeng hiramin ko ang iyong mga gamit pang-kemikal para sa eksperimento.

50. Anong oras natatapos ang pulong?

Similar Words

popularize

Recent Searches

popularkumantabulongpagkagustolawaymapadalibigongdetallanmatamanbunutanpagkataposrobertpreviouslybituinkuwintasmaidjosefakuwadernonagsagawanoongadangdaysyearpinapatapospagdukwangtaonsectionsobserverernatatawangkinapanayamnagliliyabmagnakawkasakitvibratepilipinocelebrahalikaproducts:umagangmusicalesunidosusamalamangnakihalubiloasawaikinasasabikpumiligirissumamamakasilongmadungiskatawangdinigasahanactivitymakatinakabawihisundeniablecasescorrectingdressbaotatlongpalabuy-laboyutilizaadditionally,nag-uumiritigreadgangadvertisingnagbasaparisukatbentangimportanthilingnakakasamaipantaloppamilihanmommypinilingkumainnakayukomagkitaumabotarturopawiinnapasubsobyatapinaghandaaniiwanbabasahinumaagosreportbaroakmalalamunanmanirahanmay-arisisidlandalandansapatosmatayogbayawakagawfiverremocionalkapwabalinganmagpagalingendviderenapatungosabihinmanilbihanmay-bahayuntimelybulalasvaliosamalihistulaladinimananaigmangangalakalgubatstornagagalitnakaraanmataasnakakadalawindividualmagkaparehogustonglegislativemakikipaglarobairdluboscertainmakatulogpagtangishallalexandertipidtissueboxnakasimangotprincipaleskahariannakatalungkoreturnedlikesiyongipinadakipnabigyankinuskoskahongfinishedfireworksnapatingalaipinabalothugisdadalawinpracticesnilangdisyembrepaliparinmedbayaningregulering,halu-halobangoseeeehhhhgutomestosamuyinhetodamitbringingbalediktoryannatitiyaksikoipinadeletingnakipagtagisanpusapananakotleadersjosephdiligincovidpublished,nanghihinamadmaglalakadpinapasayabagalratepasasalamatcommissionpapayahanapbuhayconectados