Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang laki ng bahay nila Michael.

2. Las plantas pueden entrar en un estado de dormancia durante el invierno, reduciendo su crecimiento.

3. Takot, nanginginig ang kanyang mga daliri.

4. Iboto mo ang nararapat.

5. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

6. I sent my friend a bouquet of flowers and a card that said "happy birthday."

7. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

8. They are a great way to use up leftover ingredients and reduce food waste.

9. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

10. Palagi niyang suot ang kanyang korona upang ipakita na siya ay makapangyarihan.

11. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

12. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

13. Saan ka kumuha ng ipinamili mo niyan, Nanay?

14. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

15. Opo. Iiwasan ko po si Anthony. putol ko sa sinasabi niya.

16. Kailangan nating magplano upang mas mapadali ang pag-abot ng ating mga pangarap.

17. Asul ang kulay ng mata ng anak ko.

18. Walang ilog ang hindi puno ng isda.

19. Over-emphasis can be counterproductive and may undermine the intended message.

20. Napansin ni Rabona na kumakapal ang buhok nito sa katawan.

21. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

22. El lienzo es la superficie más común utilizada para la pintura.

23. "Mahalaga ang kalusugan, kaya alagaan natin ang ating katawan," ani ng doktor.

24. Ang panaghoy ng kanilang awit ay nagbigay-inspirasyon sa mga tagapakinig.

25. Hindi na napigilan ni Anna ang kanyang hinagpis nang marinig ang masamang balita.

26. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

27. Amazon's customer service is known for being responsive and helpful.

28. Gaano ka kadalas nag-eehersisyo?

29. Ang pag-asa ay nagbibigay ng motibasyon sa mga tao upang magpatuloy sa kanilang mga pangarap at mga layunin sa buhay.

30. Kainis ka talaga! sabi ko sabay hampas sa braso niya.

31. She watched a series of documentaries about the history of ancient civilizations.

32. Nang matuklasan ng binatilyong apo na siya ay isang pangit na hayop na, kumarimot siya patakas sa baranggay.

33. Sa kanyang kaarawan, pinuno niya ang kanyang mesa ng mga masasarap na pagkain kaya't ito ay hitik sa mga putaheng lutong-buong.

34. La letra de una canción puede tener un gran impacto en la audiencia.

35. Nakita ko namang natawa yung tindera.

36. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

37. The library has a variety of books to choose from, ranging from classics to modern literature.

38. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

39. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

40. Uncertainty is a common experience in times of change and transition.

41. Hindi malaman kung saan nagsuot.

42. Siguro ay may kotse ka na ngayon.

43. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

44. TikTok has faced controversy over its data privacy policies and potential security risks.

45. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

46. Inflation kann auch durch eine Verringerung der Produktion verursacht werden.

47. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

48. En af de vigtigste drivkræfter i den danske økonomi er eksporten

49. Wedding planning can be a stressful but exciting time for the couple and their families.

50. Sana ay masilip.

Similar Words

popularize

Recent Searches

popularsetyembrebumababaresortyaridiagnosesgrinsboksingmatchingglobalcaneducationplaysnakakamitfridayagilityfigurestypeslearnpersistent,beyonddahilrawmagbubungaechavekonsultasyoncalidadkampeonpadabogtig-bebentealexanderbalitaseryosomateryalesnapatakbokwartospecializedtumawakategori,masipagangalsouthpongganoonpaanosamakatuwidalapaapkubyertosnamumutlabaopinanoodkaninomagta-trabahonapabalitakirottawalangmallpromotepeacemulingbilermagtanghaliankayabingonakatanggaphverpepematulungininiirognaabotinisa-isakabighanasiraamoykamandagmagsunogmatapobrengnatagosumamanatatangingnevergapnagugutomyatanamumuongkamisetasinimulannalugmokcommercialnakuhangsalu-saloangkopmaihaharapkahirapanmagpuntatinapaymagbigayanmensajesmagawapinakidalalimitedgabi-gabiiniindastarkesodisensyoeksportensilyaflashcivilizationisaacateoliviamurangkinapanayamnaglalaronoongpinabayaancarmenpuntaellakwebangmananahikomedormemorymadungisarteopportunitiesclasesroofstockwashingtonmulinapuyatpagdiriwangdemyouthdamasoriyanmangingisdabihasainterestsnamingbadingdownmarasiganpinalayaspagtuturogameedsaschoolsnilapitanhulihumalakhaktaongyunsumasaliwtaksipag-uugalinakasahodnapakagandanggayunpamansiniyasatnanlakipagkaimpaktobaku-bakonguugud-ugodnakalagaynawawalamawalalalabhanaustraliamagsugaltusindvisharap-harapangperomanghikayatindividualsdakilangboholantokpalayosukatinrequierencarbonwalngditolamanbilinkaawayperangmagawangnanatilipasinghaldumatingguitarrasupilinmitigatematalinoandy