Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1.

2. Kasya kay Suzette ang blusang na ito.

3. Ngunit wala siyang nararamdaman sakit.

4. Sino ang nakasuot ng asul na polo?

5. Really? What is he doing sa tapat ng room natin?

6. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

7. El maíz necesita sol y un suelo rico en nutrientes

8. Når vi arbejder hen imod vores drømme, kan det føles som om alt er muligt.

9. Jeg er helt forelsket i hende. (I'm completely in love with her.)

10. Ano ang nasa kanan ng bahay?

11. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

12. La música que produjo el compositor fue muy innovadora para su época.

13. Naupo siya sa sofa at inilagay yung bitbit niya sa mesa.

14. "Kung walang tiyaga, walang nilaga" ay isang bukambibig na nagpapahayag ng katotohanan na ang kakulangan ng pasensya at pagsisikap ay magdudulot ng kawalan ng tagumpay.

15. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

16. Si Jose Rizal ay isang pambansang bayani ng Pilipinas na ipinanganak noong ika-19 ng Hunyo, 1861 sa Calamba, Laguna.

17. Natapos ko ang aking thesis sa dakong huli bago ko ito isinumite.

18. Binigyan ni Jose ng pera si Bob.

19. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

20. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

21. ¿Te gusta el sabor picante del jengibre?

22. Ano ang yari ng sahig ng bahay mo?

23. Magkakasama ang mga damit nila nina Kano, Boyet at Diding.

24. Ang resiliency ng mga Pinoy ay patunay ng kanilang lakas sa harap ng pagsubok.

25. Maligoy siya magsalita at mahirap maintindihan

26. Ang dami nang views nito sa youtube.

27. Madalas lang akong nasa library.

28. Ang paglutas ng mga palaisipan ay nakakatulong sa pagpapalawak ng kaalaman at kakayahan sa pagpapasya.

29. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

30. Hindi ko maaaring payagan ang aking mga agam-agam na hadlangan ang aking mga pangarap.

31. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

32. Les enseignants sont formés pour répondre aux besoins individuels des étudiants.

33. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

34. Gusto ko dumating doon ng umaga.

35. Halos hindi niya narinig ang halingling ni Ogor.

36. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

37. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

38. The culprit behind the vandalism was eventually caught and held accountable for their actions.

39. Dalawampu't walong taong gulang si Paula.

40. Más vale tarde que nunca.

41. Wala nang iba pang mas mahalaga.

42. Inaamin ko na ang pagkakamali ko.

43. Las hojas de té son muy saludables y contienen antioxidantes.

44. Sana po ay maibalik ko pa ang panahon upang mabigyan sila ng kasiyahan.

45. Matumal ang mga paninda ngayong lockdown.

46. Di nagtagal, muli niyang naramdaman na tila nangangalirang na naman ang kanyang balat.

47. Isang Saglit lang po.

48. Ano ang pangalan ng hotel ni Mr. Cruz?

49. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

50. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

Similar Words

popularize

Recent Searches

exhaustedpopulariyanmakilingkalongninailocosdrewpaawellreducedsumakitcreatestructuremaratinginterviewingmalakinganimgivekulogmuchtonosparkvampiresbasahanmegetbilaomayomaninipisbisitainspiredtiyapracticadolastinglibrehardnaghandangkumananelementarysaanarawsesamelawaysumalalumibotjennymagulangtuwidganidgamotdi-kalayuanadvertising,shopeepinakidalanariyanyumaofitnessadvertisingalmusaldolyarkasaltripknowumaliswonderstagalogmanghulinakitaeleksyonmagingmustsumamapinalambotikinakagalitiba-ibanghabangnagbakasyonmabangomakapangyarihansalu-salofriendskatutubopumayagkarapatannailigtasmaruruminagpapanggapmahalinbayabaslugardollaranimoytoothbrushdulot1940nakikini-kinitaambisyosangmahahalikkarwahengmakidalotulongbagalreynaeksportenfollowedkaragatanhalamanannagpatuloykatawangpinakamatapatpapagalitanmagalangpandidirimahiyapinabulaanpaciencialansanganafternooniniuwiminatamisfarmpulissumingitnetflixnayhalamanangwakasnaghubadisinamanabigkasrewardinglagunapangilsocialewifibumigaybumabagjocelynipaliwanaganywherelandoresumenskyldes1973pyestaulamsafeactingtakeenchantedpinanghelpedprogramminginfluenceumarawboxkaraniwangsikrer,abuhingcertainbesideskumakainnapaluhapinuntahanbulatesangugatenergyflamencoemocionessasakyannaglakadganapintugonpambahaylolohjemstedtechnologiesnagagandahannagkakamalinamuhayhinihintayisinaboylumagopinakamahabalalakembalokumbentoabanganbrainlywastemabaitiilanwestpointpalayoknaggingbringingdisyemprelumakad