Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

2. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

3. Kailangan kong lumakas ang aking loob upang maalis ang aking mga agam-agam sa aking mga pangarap.

4. I prefer to arrive early to job interviews because the early bird gets the worm.

5. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

6. Hindi siya maramot sa pagbibigay ng kanyang mga lumang damit sa mga nangangailangan.

7. Payat na payat na ang ama't ina niya para matustusan ang kanyang pangangailangan.

8. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

9. Hindi ka ba papasok? tanong niya.

10. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

11. Hindi ko masikmura ang pumatol sa walang kalaban laban.

12. Arbejdsgivere leder ofte efter erfarne medarbejdere.

13. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

14. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

15. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

16. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

17. Nakaupo ako nang matagal sa sinehan.

18. Napatakbo ako sa kinalalagyan ng landline ng tumunog yun.

19. Lumungkot bigla yung mukha niya.

20. Ang panaghoy ng kanilang awit ay nagbigay-inspirasyon sa mga tagapakinig.

21. May sapot pa ng gagamba sa kanilang kisame.

22. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

23. Ang mga parangal na natanggap ng atleta ay nagpapakita ng pagpapahalaga at itinuring na tagumpay sa kaniyang larangan.

24. Diyos ko, ano po itong nangyayari sa aming anak?

25. Ang maaamong hayop ay nagiging mailap dahil sa pananakit ni Kiko.

26. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

27. Hinding-hindi napo siya uulit.

28. Saan siya kumakain ng tanghalian?

29. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

30. The athlete completed a series of intense workouts to prepare for the competition.

31. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

32. Ano ang alagang hayop ng kapatid mo?

33. Nagbigay ang albularyo ng anting-anting upang protektahan ang bata sa masasamang espiritu.

34. Bakit mo siya binilhan ng kurbata?

35. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

36. Me gusta preparar infusiones de hierbas para relajarme.

37. The culprit behind the product recall was found to be a manufacturing defect.

38. The stock market can be used as a tool for generating wealth and creating long-term financial security.

39. I'm sorry, I didn't see your name tag. May I know your name?

40. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

41. Pare-pareho talaga kayo mga babaero!

42. Las serpientes hibernan durante los meses más fríos del año, reduciendo su actividad metabólica y buscando refugio en lugares protegidos.

43. The beach has a variety of water sports available, from surfing to kayaking.

44. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

45. Los cuerpos de agua ofrecen un hábitat para una gran diversidad de especies acuáticas.

46. A penny saved is a penny earned

47. Nagbigayan kami ng mga regalo noong Pasko.

48. Transkønnede personer kan vælge at gennemgå hormonbehandling og/eller kirurgi for at hjælpe med at tilpasse deres krop til deres kønsidentitet.

49. Umalis na siya kasi ang tagal mo.

50. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

Similar Words

popularize

Recent Searches

nag-replyyourself,restaurantsetyembremalumbaypopularwaterinakyatcharismaticsalamestganapisocelularesbasahinamowalazoosuccessfulbatabilhinjackyreservedayudalasingerodalandansnobroonconvertidasgranbulongjoypapuntadaangdayinfluentialnagingataquespedenutrientesbalesourcesecarseflyconditioninglibroincreasedinitdingdingefficientconsiderarphilosophymasshortikinabubuhayforminombasketballsinagotmaynilamarinigpautangpakikipaglabanquezonpagpalitmamanugangingpagpatakbopanalomahalinhamoncommissionyumabangdarnareturnedclubimportanteturonagsalitaseekmaya-mayawalongwaringvideotryghedcalidadelepantemalamigpinaulananhiramin,masasakitkindleroboticsreservationmasayangpagtangisbenunfortunatelyantokkansernapakaalattodobangkongpakilutomababasag-ulomakasakayamangbecamehumpaynag-away-awaynag-aaralfestivalmaiingayvegaspalapitkagipitanvanbehaviorsuchunibersidadpinagtagpomurang-murasponsorships,divisoriabumisitanag-iisaglobalisasyonpaglalabadasimbahannagpaalamkapangyarihanmagpaliwanagnagre-reviewmaglalakadpamanhikansabadongmaramotstrategiesmawawalamabihisanleaderskanikanilangikukumparamatalinosasagutinmaliksirebolusyonsasamahanpagkatakotnakaraansiksikannagsinecompanynaglarobalahibonangangakosaan-saankinumutanngumingisilumuwasnagwagipagkaangatlumabannaabotyonpancitinuulcersubjectbinatilyongsoundrimaslasongothers,respectpositibomaaamongnagpasalamatlakimarierosariosipagsinehanorkidyasiikutanmahabolpatawarinnakarinigcruzsinisiraginawaranlagnatpaparusahantaxidadalawmisyunerongsunud-sunodgirayeroplanomasungittaksi