Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

2. Lumabas ng simbahan ang mga tao nang limahan matapos ang misa.

3. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

4. Ilang gabi sila titigil sa hotel?

5. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

6. I love the combination of rich chocolate cake and creamy frosting.

7. Muchos agricultores se han visto afectados por los cambios en el clima y el medio ambiente.

8. He was a pioneer in martial arts and fitness and his teachings are still relevant today

9. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

10. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

11. Magkano ang isang kilong bigas?

12. Bumibili si Rico ng pantalon sa mall.

13. Hindi maganda na maging sobrang matakot sa buhay dahil sa agam-agam.

14. Ang digmaan ay isang matinding kaguluhan sa lipunan at pangkalahatang kapaligiran.

15. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

16. Nagbago nang lahat sa'yo oh.

17. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

18. Ang batang matuto, sana sa matanda nagmula.

19. Oo nga babes, kami na lang bahala..

20. The website's content is engaging and informative, making it a great resource for users.

21. Pinaghihiwa ko ang mga kamatis.

22. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

23. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

24. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

25. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

26. Kumain ako ng itlog kaninang umaga.

27. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

28. Kapag may kailangang desisyunan, hindi maiiwasan na magkaroon ng agam-agam sa kung ano ang tamang hakbang.

29. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

30. Puwede siyang uminom ng juice.

31. Ang aking anak ay madalas manood ng Baby shark sa youtube.

32. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

33. Satu titik hitam bisa merusak noda yang putih.

34. The politician made a series of speeches, outlining her plans for improving healthcare.

35. Ang pagkakaroon ng mga pahiwatig o palatandaan sa kabanata ay nagbigay ng hint sa mga mambabasa tungkol sa hinaharap ng kuwento.

36. Elektronikken i en flyvemaskine kan hjælpe med at overvåge flyvningen og opretholde sikkerhed.

37. They are often served with a side of toast, hash browns, or fresh greens.

38. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

39. Nagsisilbi siya bilang public servant upang matugunan ang pangangailangan ng kanyang nasasakupan.

40. Sa gitna ng pagdidilim, napansin ko ang nagliliwanag na ilaw mula sa aking bahay.

41. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

42. The character in the movie was content in his simple life, believing that ignorance is bliss.

43. Ang bilis naman ng oras!

44. Las plantas de interior son populares para decorar espacios dentro de las casas u oficinas.

45. Bis bald! - See you soon!

46. Isang araw nagkasakit si Aling Rosa.

47. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

48. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

49. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

50. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

Similar Words

popularize

Recent Searches

popularpagkaawalabismedikalhuwebesingatandi-kawasatrentalagistopsaktanunattendeddraybermangingibigbetatagalognagbagoneedssumamaihahatidkumidlattungkodadmiredamazonpumulotattackechaveshetprimerkumarimotrebolusyonsedentarybloggers,hapdinapakakumaennakakainlunesenglishbumibiliuridumapanutrientes,allowedfreelancernakatunghayeskwelahankonsultasyonculturasliv,sponsorships,inastapesooffernahigaflamenconagtataemawawalatumirakidkirandollarnagpatuloymakuhangseriousbatonatanongseekinfinityinalokaksidentenagpabayadnalalabingbawatnagtrabahololapalagingbakasyonmatindingsumasambaeleksyonreplacedmakapagempakepopcornsignsourcechesscommercesulingangitnaguidecontrolasutilinterpretingso-calledicepagtatanimmagselossilyatiningnancurtainsblessbalahibomabaitgoodeveningpartnerbalikatsocialeinterests,publicationjobsgayunmanbakuranmarangyangagostopagsasalitaeveningmatangkadpaki-chargebayanghimhinagud-hagodwidenalangsinasakyantiradornagpasamabilihinmagkamalilalakebarung-barongheartbeatnakaupopoorerbagkusideyabinatakikinamataysidocongratsspendingtwitchdisenyoipatuloyintroducepagiisipiilananayawitsorpresangpuntaorugakaarawantinderanangangaralgabeclaseslabing-siyamalexanderformsulyaplapitanfatherbibilhintinaymartialtinataluntonpinapataposcolourhinanakithouseholdspinapasayaiconspakanta-kantangproducerernovembernamataymauliniganlarangannapagtantotigasbulongotrasbumigaybarangaypagpapatubobabecharismaticpinagkaloobanputahebarriers1982hvernabiglapangalanmagpa-picturenagsisigawmedidanapililaryngitishimself