Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Los niños son propensos a sufrir de tos debido a infecciones respiratorias comunes, como el resfriado común y la gripe.

2. Huwag kang lalayo nang palayo sa amin para hindi ka mawala.

3. Batang-bata ako nalalaman ko 'to.

4.

5. The patient's family history of leukemia increased their risk of developing the disease.

6. Magalang na nangumusta si Ana sa kanyang mga magulang pagkatapos ng isang mahabang biyahe.

7. Ang talento ng mga Pinoy sa pagkanta ay hinahangaan sa buong mundo.

8. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

9. Sa kabila ng paghihinagpis, nagsikap ang mga residente na bumangon matapos ang trahedya.

10. I was going to surprise her, but I accidentally spilled the beans.

11. Sayang, apakah kamu mau makan siang bersama aku? (Darling, would you like to have lunch with me?)

12. Halika, i-recharge natin ang baterya mo.

13. Wala na ang beyblade at ang may-ari nito.

14. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

15. Napalayo ang talsik ng bola nang ito’y sipain ni Carlo.

16. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

17. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

18. Kanina pa kami nagsisihan dito.

19. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

20. Magkita tayo sa parking lot ng Luneta Park.

21. Nagsisipag-uwian na ang mga mababangis na hayop at ibon sa kanikanilang itinalagang mga lugar nang makita nila si Paniki.

22. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

23. Danmark eksporterer også en betydelig mængde medicinske produkter.

24. Limitations can be self-imposed or imposed by others.

25. Hindi ko maaaring pabayaan ang aking mga agam-agam dahil ito ay maaaring magdulot ng panganib sa aking buhay.

26. Ang ibon ay mabilis na lumipad palayo matapos itong pakawalan mula sa hawla.

27. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

28. The government is working on measures to reduce traffic pollution in urban areas.

29. Sa pagpapakumbaba, maraming kaalaman ang natututunan.

30. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

31. The king's royal palace is his residence and often serves as the seat of government.

32. Kumain ako sa kapeterya kaninang tanghali.

33. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

34. Umiling ako, Wala naman. Akala ko kasi kakilala mo sya,

35. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

36. Les étudiants peuvent poursuivre des études supérieures après l'obtention de leur diplôme.

37. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

38. In this industry, singers who can't write their own songs are a dime a dozen.

39. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

40. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

41. Mahirap makipagkita ng basta-basta, kaya sana pwede ba kita makilala?

42. mga yun. Ang mahalaga ay makapagempake ako agad.

43. Ang kanyang boses ay napakahinahon at mababa.

44.

45. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

46. The bird sings a beautiful melody.

47. Les patients peuvent avoir besoin de soins psychologiques pendant leur hospitalisation.

48. Sa tagal nilang nagsama ay hindi sila pinalad magkaroon ng anak

49. En invierno, se puede disfrutar de hermosos paisajes cubiertos de nieve.

50. Ikaw na nga lang, hindi pa ako nagugutom eh.

Similar Words

popularize

Recent Searches

missionpopularfiverrpetergoodeveningitonglabingaywanfistsactionleefanscynthiaiilantsupermaisi-googleboseshinabaresourcestsaamaihaharappagkaimpaktonagkapilatgandahannabighanitaga-hiroshimaumuwibuwenaskommunikererneardiyanskirtchinesebakanteuwakteachingsmaibainiangatreviewturonnagdaosmarielahhhhbibigyanbinigyangbotongshinesiyankagandaatinpotentialyesconventionalbulamarkediintayinnakadapapagkuwapagkakayakapkonsentrasyonkagandahagtuluyanmangiyak-ngiyakwalang-tiyakpagluluksamemorysequekitthroughlead2001ibinilihoneymoonmedicalnakauwinaliwanaganhandaanmagkaharapnagmistulangpinagbigyannapipilitannanlalamigo-onlinebulalasmagtatakagawainbangkangroofstockmakaiponintensidadsagutintemperaturaawtoritadongpinangalanangabut-abotmataaashinukaykainanmaawaingsabongmatiyakpinaulananmatutulogsakyanoperahanpantalongconsumeuboskyldesnoonbigongjennyenergyhastawinsshoesbinawianbiggestpetsaroonsumugodvideoasimpostcardpalapitmaestrobarobuwanclassesscottishcuandorestbasacontrolledatingspawowwellcoachingscienceoncebarrerasrevolucionadonapakatalinomatagal-tagalnaninirahanpagbubuhatansoccernakakasamapatalikodnagtatanongyakapinpaghahabiipinatawagsumusulatsinisirafulfillmentpoorertenidonalangnagpasamapasasalamattalinodalawlaybraribalangmataomandirigmangpanindangmarvinnapadpadbilaobairdganasweethuwebestelangkwebangpaatiyawidekinakawitannaka-smirknakasahodkinatatalungkuangpinagmamalakipagkakatuwaanpaghalikkayabangannakatulognasulyapankalaunanhumihingiika-12pakakasalancruzsignalmatagumpaymagsaing