Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Halos hindi niya narinig ang halingling ni Ogor.

2. Tak ada gading yang tak retak.

3. My grandma called me to wish me a happy birthday.

4. Nagtatrabaho ako tuwing Martes.

5. Natuto siyang lumaban sa kaniyang mga magulang.

6. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

7. The French omelette is a classic version known for its smooth and silky texture.

8. Berapa harganya? - How much does it cost?

9. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

10. Budgeting, saving, and investing are important aspects of money management.

11. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

12. Ang aso ni Lito ay mataba.

13. Nagugutom na din ang mga tao sa lugar nila at ang dating mapagbigay na mga tao ay nag-aagawan na.

14. Eh ayoko nga eh, sundae lang talaga gusto ko.

15. Hey! Wag mo ngang pakealaman yan! sigaw ko sa kanya.

16. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

17. Mas maganda kung magbigay tayo ng oras at atensyon sa mga kabuluhan kaysa sa mga kababawan.

18. El conflicto entre los dos países produjo tensiones en toda la región.

19. Hindi ko alam kung nagbibiro siya.

20. Ang tunay na kayamanan ay ang pamilya.

21. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

22. The team's performance was absolutely outstanding.

23. Nasa park sila at pinagmamasdan niya ang mga bata na naglalaro sa paligid.

24. She has been learning French for six months.

25. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

26. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

27. La prevención del uso de drogas es fundamental para reducir los índices de adicción.

28. Sino ang binilhan mo ng kurbata?

29. We didn't start saving for retirement until our 40s, but better late than never.

30.

31. Ang manunulat ay nagsusulat ng nobela na nagpapakita ng kaniyang malikhain na imahinasyon.

32. Mamaya na lang ako iigib uli.

33. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

34. Ang pag-aaway ng magkasintahan ay hindi tama, at mas maganda ang pag-uusap para malutas ang mga problema.

35. Forgiveness allows us to let go of the pain and move forward with our lives.

36. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

37. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

38. Ang pagguhit ay isang paraan upang i-express ang mga emosyon at ideya.

39. Beast... sabi ko sa paos na boses.

40. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

41. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

42. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

43. Mucho gusto, mi nombre es Julianne

44. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

45. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

46. Disente tignan ang kulay puti.

47. Busy sa paglalaba si Aling Maria.

48. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

49. Lumapit siya sa akin at sumandal sa may sink.

50. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

Similar Words

popularize

Recent Searches

manghulielectoraleclipxecarriedpopularsubalitarghasimpostcardokaysigeisinalangnasabingkainsenatemaluwangbawatmariobalikbugtongstarsumugodscientificmegetsumamawalispumuntasumusunoearndinalawsinumanninyomapuputimentalpyestamillionscoachingjuicethenformasfatmaaringpakpakwouldgraduallyrelevantmananakawcontentfarmetodeinspired4thsumapitnaroonpagkamulatpundidoprogramaprogresscurrenttypescontrollediginitgitbasaryancharitablelasingtechnologysalarinstruggledtahimikninongsaranggolakitabayanidamdaminkahirapanbehalfnagpasyasasagutinbulaknamungaexpertspeechreorganizingtinahakmiyerkolestinioprovidedmadalisalu-salonaninirahanmaglalakadikinasasabikpagpapakalatmagpa-picturenagagandahanNakatuonnakakagalahubad-baronegosyanteespecializadasnananaginippagkakalutopaghalakhaknapaluhataga-nayonkinagagalaknakatapatpamilihannagcurvemahuhusaynasisiyahaninakalangmagagandangnagkwentohumahangosentrancemonsignornamumulaklakdistanciathanksgivingpagamutannasasalinanmagbibiladkalakinagdadasalpakikipagbabagibinibigayumiinomfilipinayakapinpagsayadpinangalananisinaboylumagonagsinetumamisfysik,vidtstraktpartsumiisodhulihansisikatkailanmansementongnakauslingnagpasamahinanakitnabiawangtinatanongkangitanlansangansalaminranaymaya-mayatanyagpesoikatlongmaskinerpiyanonamilipitnauntogsusunodiniirogcramerespektivedadalocalidadinstitucionesbagamamawalabantulotdisciplinsakayde-latagatolnagpasannagniningningbandalagunabuntiskutodkasuutanbagalsalbahebumuhosgagambabinibiliangelafederalprosesolintamapahamaktshirttrensinimulanbinulongmalikotnaiinitanamin