Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

2. He is having a conversation with his friend.

3. Ang pangalan niya ay Mang Sanas.

4. Napakaganda ng mga pasyalan sa bansang Singapore.

5. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

6. May dalawang libro ang estudyante.

7. may butil na rin ng pawis sa kanyang ilong.

8. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

9. Napansin ni Rabona na kumakapal ang buhok nito sa katawan.

10. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

11. Nagtataka ako kung bakit hindi mo na ako tinutulungan tulad ng dati.

12. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

13. The stock market gained momentum after the announcement of the new product.

14. Si Josefa ay maraming alagang pusa.

15. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

16. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

17. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

18. Pakilagay mo nga ang bulaklak sa mesa.

19. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

20. Siya ang aking pinakamatalik na kaulayaw sa opisina.

21. Para sa anak ni Consuelo ang T-shirt.

22. The library has a variety of books to choose from, ranging from classics to modern literature.

23. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

24. Maaring ibigay ng guro ang libro sa akin.

25. Pakibigay ng oras para makapagpahinga ang iyong sarili.

26. I admire my mother for her selflessness and dedication to our family.

27. Alas tres ang alis ng tren tuwing hapon.

28. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

29. Emphasis can help to ensure that a message is received and understood by the intended audience.

30. El mal comportamiento en clase está llamando la atención del profesor.

31. En invierno, los días son más cortos y las noches son más largas.

32. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

33. Gaano karami ang dala mong mangga?

34. Tuwang tuwa ang mga tao dahil magaganda ang kanilang ani.

35. Musk has been involved in various controversies over his comments on social and political issues.

36. La paciencia es una virtud que nos ayuda a ser mejores personas.

37. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

38. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

39. Keep studying and hang in there - you'll pass that test.

40. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

41. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

42. Have they made a decision yet?

43. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

44. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

45. Matapos ang matagal na paghihintay, ang aking pag-aalinlangan ay napawi nang dumating ang inaasam kong pagkakataon.

46. Ilang kuwarto ho ang gusto niyo?

47. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

48. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

49. Nagpunta kami sa peryahan kagabi.

50. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

Similar Words

popularize

Recent Searches

magtipidpopularcarmenadvancesiglokumatoknaiinitanplasalenguajepublishing,briefmalapadnilangsoresukatgisingdeterioratelutospentbigotebranchpagodlagingnakakulonglaylaytse1920spisoparkingkasopumatolexhaustedpanonakatinginggandakelanmalakikinseluiscondoforcesumiinitrichgodpowerthensorryreducedbuwalimpithimselfinspiredrolledincreasedlefthowevertelevisedjunioipipilitataqueslorenaseguridadconcernssongssisikatsayoputahenakakatakotincidencehvortumamislupaininiangatnakatagomidtermtiposrisenoonkamaliansakoptabihanpakilagaykagipitancarolstandpassionnohputolfilmpagkamanghapapagalitantatawagpaglalaitnakakitamakikiraanbuwanmahahanaysakristannawalangnalagutancultivanahuhumalinggulatkatawangkumaliwatumahimikmahahaliknanlalamignakakarinigbusinessesestudyantenakuhanakatulognagdiretsotobaccoiwinasiwasnagtataetabingpagpanawnakilalaalas-doslandlinelalabhanhuluuulaminbisitatitaaddingbighaniiwanankulturtamarawpinabulaannatutulogna-curioussignalpakibigyannationalsugatangnag-iyakanidiomabopolstatlongadmiredkumaenpananakitbasketballmaligayaflamencokaugnayannobodysumingitjocelynnahigabuhokdumilimhikingnahulaantransportationsisipaintulangfionalendingamolikessinumangpaskonglalaitutolbigyanparinhinigituuwireservescongresslamesajokeginangmodernnahulimrssnabutihingrailwaysnasaktancampanimonilinissumarapsusunduinpisingmemorialverymisusedtryghedpakelamharingsurgeryaltspa