Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

2. Mucho gusto, mi nombre es Julianne

3. Paki-charge sa credit card ko.

4. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

5. El discurso del político está llamando la atención de los votantes.

6. Naghahanap ako ng mapa ng bansa para sa aking proyektong pang-geography.

7. Kapag mayroong mga hindi inaasahang pangyayari sa buhay, madalas na nagkakaroon ng agam-agam sa mga tao.

8. Buhay ay di ganyan.

9. Ngayon ko pa lamang nakita ang halaman na ganito.

10. Bibili rin siya ng garbansos.

11. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

12. Panahon ng pananakop ng mga Kastila

13. Wala nang iba pang mas mahalaga.

14. He is painting a picture.

15. Bakit ka tumakbo papunta dito?

16. Work can also have a social aspect, providing opportunities to meet new people and make connections.

17. Ang nagdudumaling helicopter ay masigla na naglilipad sa himpapawid.

18. Sila ay nagsisilbing modelo ng katapangan, katapatan, at pagmamahal sa bayan.

19. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

20. Protecting the environment requires a collective effort from individuals, organizations, and governments.

21. Sa sobrang dami ng mga dapat gawin, may mga pagkakataon na naglilimot siya sa ilang mga mahahalagang mga takdang-aralin.

22. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

23. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

24. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

25. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

26. May maruming kotse si Lolo Ben.

27. Napapatungo na laamang siya.

28. Kahit ilang beses ko na siyang tawagin, tulala pa rin siya sa kanyang pagmumuni-muni.

29. Nasawi ang drayber ng isang kotse.

30. Taman Safari Indonesia di Bogor adalah tempat wisata yang menampilkan satwa liar dari berbagai belahan dunia.

31. She is not studying right now.

32. Pedro! Ano ang hinihintay mo?

33. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

34. Stop crying and pull yourself together, we have work to do.

35. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

36. Salatin mo ang mga butones ng remote upang mahanap ang tamang pindutan.

37. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

38. Pagkatapos nila mag-usap at pagkapasok ni Helena sa kanyang kwarto ay nilapitan ni Haring Bernardo ang binata at kinausap ito

39. Naniniwala ang mga Katoliko na ang mga dasal para sa mga kaluluwa sa purgatoryo ay makakatulong sa kanilang kaligtasan.

40. Amning er en vigtig del af den tidlige babypleje.

41. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

42. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

43. Ito lang naman ang mga nakalagay sa listahan:

44. Sige ako na ang isa pang sinungaling! Bwahahahahaha

45. Tu peux me passer le sel, s'il te plaît?

46. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

47. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

48. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

49. This can be a good way to grow your wealth over time, but it also carries risk

50. Papunta na ako dyan.

Similar Words

popularize

Recent Searches

populardikyamarturogivehadpapasalalapagdiriwangmag-asawanginantokpetrhythmnakakatandananinirahanphilosophicalbalancesnakakagalingbumitawcasesgodfredresumenimpitrisemumuntingpagkaangattherelivespooreranghelkabarkadacanteenalagangsumalakayanthonyenglishe-commerce,sumiboldistansyapalapagmaghapongdaramdamincaraballofarbinasapamagatlimosjustchoicecontent,pagtiisanfaceinabutanbarohverrevolucionadotrasciendetheirsinkbilibidriskmanuksomaluwangkomedornangingilidaeroplanes-allsmokinggamitinvivakalaromaghilamosbinibilireferssondecisionsdarktodayjoketumakbocomemagpahabalalabhansikopitakanapakonanunurilivetripmagsasalitamaaringsusithingsgowntrafficcommunicationbeenkagandatuktokkinainnageespadahanvednagagandahansueloahhhhcareerpatayalwaysmagkapatidmakulongkargahanpinamalagiencuestasendingkinalilibingannakakasamadetectedworkingprinceothers,longclarafulfillmentmagtakamaskinerlasfacilitatingfencingimproveikinamataymedikalcitizendevicessmallpumuntasistemasintroducehusoikinabubuhayformamaarawjunioemphasisfitnowfulfillingpasalamatanstarredsumusunodeventsforcesserumakbayshortmahabolideasmauuposarasaritadiagnosesiniwaninfinityinagawnagreklamouniversitieskingphysicallendinginspireleukemiasummernanahimikmagpa-pictureagapresenceilihimnalugodfreeanothertonightmarketing:nahulogmostnakakasulathowevermaaaringdumiretsonatutuwamakakawawaartsbilerngumingisifurtherpalagibauli-rechargehvordevelopedpowercomunesunattended