Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Bakit wala ka bang bestfriend?

2. Kumaen ka na ba? tanong niya sa akin.

3. Crush kita alam mo ba?

4. Nangyari ang aksidente sa daan kahapon kaya maraming sasakyan ang naabala.

5. Naglalaway siya sa bango ng kape na inilabas ng coffee shop.

6. Gusto kong mag-order ng pagkain.

7. Masdan mo ang aking mata.

8. Eine klare Gewissensentscheidung kann uns helfen, Verantwortung für unsere Handlungen zu übernehmen.

9. Late ako kasi nasira ang kotse ko.

10. At siya ang napagtuunan ng sarisaring panunukso.

11. Kinilig ako pero di ko pinahalata, whatever.

12. Nang magbabayad ako ng pinamili ko't kapain ko ang bulsa ko, e wala nang laman!

13. Ang taong maramot ay madalas hindi sinasamahan ng iba.

14. Si Chavit ay may alagang tigre.

15. Pupunta ako sa Madrid sa tag-araw.

16. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

17. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

18. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

19. Natawa nanaman sya, Hindi, maganda sya.

20. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

21. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

22. Tanghali na akong makauuwi nito, nausal niya habang binibilang sa mata ang mga nakapilang balde.

23. He admired her for her intelligence and quick wit.

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. By the way, when I say 'minsan' it means every minute.

26. I have been taking care of my sick friend for a week.

27. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

28. Maaari po bang makahingi ng sobra sa hapunan ninyo?

29. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

30. A king is a male monarch who rules a kingdom or a sovereign state.

31. Naglalaway ang mga bata sa tuwing nakakakita ng mga kendi at tsokolate.

32. Sumasakit na ang kanyang sikmura dahil hindi pa rin sya kumakain simula kaninang umaga.

33. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

34. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

35. Pumupunta ako sa Laguna tuwing Mayo.

36. Nagdiriwang sila ng araw ng kalayaan.

37. Sapagkat misyunero, marami ang naliwanagan sa katotohanan.

38. Masyado ka naman nagpapaniwala kay Andrew!

39. Ang buhawi ay maaaring magdulot ng malawakang pinsala sa mga ari-arian, gusali, at mga taniman.

40. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

41. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

42. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

43. Nagandahan ako sa pagtatapos ng libro.

44. Mag-usap tayo sa WhatsApp o Line.

45. Give someone the cold shoulder

46. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

47. Nagulat ako sa kanyang biglaang pagbisita, ngunit ito ay nagdulot ng kasiyahan sa aming pamilya.

48. Maraming lumabas na balita ukol kay Pangulong Manuel L. Quezon.

49. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

50. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

Similar Words

popularize

Recent Searches

popularkoreabosesableabovecommunicationmalakingagila1977silayanuhetofallkarwahengafternoonnaghubadpiyanohumihingirespektivemusicdepartmenttinatanongnanamanibinalitangdiferentesburdenmapaikotspecialfeelgueststingsinipangbriefmayamangforståfe-facebookbutikargangipagmalaakialletibokfauxpakilutotshirtbumabagkinsevetokasakitklasengmamanhikannalalabivirksomhedernagpatuloynakaupoikinasasabiknakakasamanamumulaklaknakakadalawmagpa-picturesundhedspleje,kumirotjejumagbibiladiniindapaglalabapahiramtumunognaglaholumindolnabiawangmagsisimulapaulit-ulitmabatongtumamisnakahainlumabasburgerulotechniquesvisfilipinapinaghatidanpagtinginnakasahodnagkwentomakidalonakakagalasouthmatangumpayisubohihigitsarongtenidode-latahinilahuertomenossolarmeaninghitikwerebiglaindustrytsenagsinegatasbalingtelangstillsweethangaringrosabecomelamangplasaattackresourcesmagbubungasettingmetodelabanantwinkleeducationalplaysdonemeannaritotandaseanapakasipagmakikiraantekakinatatalungkuangpanatagilalagayskyldes,kalaunankamakailantamarawvegasipinangangaknapakombinationitutolkinabukasanfar-reachinglangutak-biyacapitalistamolamannamangiginitgittryghedbiglaannabahalamasukolpneumoniagumagamitingaydeathtiposmisyunerongagilityblazingsangvariedadpakibigayfinalized,itongtwitchtapatblusangnoblegabrielpabilimaibigaypalamutipaliparinmiyerkulesplantasnag-aagawannakikilalangsaranggolabiocombustiblesnakakapagpatibayunattendedcourtnegosyantepagsisisisikrer,landlinelumakipambatanglalakiforskel,pakakatandaanmanagerkinuhadistancia