Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ayaw mong magkasakit? Kung gayon, dapat kang kumain ng masusustansyang pagkain.

2. Inilabas ng guro ang kanyang laptop sa silid-aralan upang ipakita ang kanyang mga presentasyon.

3. Ang taong maramot ay madalas hindi sinasamahan ng iba.

4. Napakagaganda ng lumahok sa beauty pageant.

5. The game is played with two teams of five players each.

6. Alam ko.. sinabi niya sa akin yun..

7. Masaya naman talaga sa lugar nila.

8. The athlete completed a series of intense workouts to prepare for the competition.

9. Ang magnanakaw ay kumaripas ng takbo nang mabisto ng tindera.

10. Ang panaghoy ng kalikasan ay naririnig sa bawat pagkalbo ng kagubatan.

11. Pagkatapos nila mag-usap at pagkapasok ni Helena sa kanyang kwarto ay nilapitan ni Haring Bernardo ang binata at kinausap ito

12. Can you please stop beating around the bush and just tell me what you really mean?

13. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

14. Umalis na siya kasi ang tagal mo.

15. Las vacaciones son una época para compartir regalos y mostrar gratitud.

16. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

17. Nagagalit ako sa mga sakim na mga minahan.

18. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

19. Ang pamilya ang sandigan sa oras ng kagipitan.

20. Gumawa ng pangit na drowing ang kaibigan ko.

21. Walang sinumang nakakaalam, sagot ng matanda.

22. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

23. Ewan ko apelyido pero basta Memo, kilala ka kasi nya eh.

24. Ang malakas na pagsabog ng bulkan ay binulabog ang buong komunidad.

25. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

26. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

27. He's always the first one in the office because he believes in the early bird gets the worm.

28. Det er også vigtigt at spise en sund og afbalanceret kost for at støtte ens træningsmål og sundhed generelt.

29. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

30. Bumili sila ng bagong laptop.

31. Kaya't pinabayaan na lang niya ang kanyang anak.

32. We admire the courage of our soldiers who serve our country.

33. Paano umuuwi ng bahay si Katie?

34. The sports center offers a variety of activities, from swimming to tennis.

35. Después de hacer la compra en el supermercado, fui a casa.

36. La paciencia nos enseña a esperar el momento adecuado.

37. Ano ang ginawa ni Tess noong Abril?

38. Sa anong materyales gawa ang bag?

39. Bunga ng globalisasyon ang pag-unlad ng maraming industriya sa iba't-ibang bansa.

40. Nakapunta ako sa Bohol at Cebu.

41. Kumain sa canteen ang mga estudyante.

42. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

43. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

44. Nang mawalan ng preno ang sasakyan, aksidente niyang nabangga ang poste sa tabi ng kalsada.

45. Ang kanyang galit ay nagbabaga sa ilalim ng malamig niyang mga ngiti.

46. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

47. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

48. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

49. Ipanghampas mo ng langaw ang papel.

50. Magpapabakuna ako bukas.

Similar Words

popularize

Recent Searches

violencepopulargagiyanmeansnag-replypasigawfrescomalumbaydisposalpatunayanlandebagaysetyembremakahingibumigaylaybrarikahilinganmagkasinggandadailymagtipidyarioutlinedumaanibinalitangtalentbumabagilawnuhmalihisartistsilocoshappenedmataposparinpongcarriedsusulitbinataklenguajedisyembrebilibbritishlegacypaskonglinawmayamandikyamutilizariyonlumilingonroselleplasalilygardenkasaysayanadditionally,kaugnayanlistahanstockscnicoklasengsineisamaayawkombinationkalonghikingnasancolorincidencekatapatproudmatabangchickenpoxcompositoreskasakitskyldesmatapangtrajeinakyatfatherbalatsumingitsiglomabaittradisyontiningnanambagkontingpagputikahitandresbigongdeletingbuntisumalissusipeppypresleymayroongasiaticalasiatfbinangganamakulangparimatigaslagunainiintaykatagalaninimbitacomunicantokyopublicationkriskamarianatulogpublishing,scottishyeynenapancitginawateacherinvitationsapatgrammarsacrificeangaltinikvivaheartbreakorganizeparomaistorbomediatibigpebrerocubicleanamissionplagaskamustahitiklayawneed,inalagaancarriesexpertiseaddictionkumbentoproductskulotmarangyangbinibilangproducts:nyanmustklasrumsilyanatagalanpusapangilbumiliumakyatsumisilipnakinigmagnifytssswifinunosamakatwidsalitangsumisidjuaniigibkuwebakasalananbagkusninyopinagkasundobinulongnakatingingwerehiningigoshkahusayanwikakirottsuperindividualscarlogustotinitindadeterminasyonoverallahassystematisk