Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. "Every dog has its day."

2. Mayroon ba kayong reaksiyon, Senador Ferrer?

3. Malamang na tamaan ka pa ng kidlat.

4. Wala ka naman sa kabilang kwarto eh.

5. Madalas akong nakakarinig ng kakaibang ingay sa labas ng bahay sa hatinggabi.

6. The concept of money has been around for thousands of years and has evolved over time.

7. Unti-unti na siyang nanghihina.

8. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

9. Gusto kong matutong tumugtog ng gitara.

10. Wala na siguro sya, baka natulog na inantok na.

11. Inalok ni Maria ng turon si Clara.

12. Ang mga dentista ay mahalagang propesyonal sa pangangalaga ng ngipin at bibig, at mahalagang sumunod sa mga payo at rekomendasyon nila upang maiwasan ang mga dental problem.

13. Wala na ang beyblade at ang may-ari nito.

14. Sa gitna ng kalsada, napansin ko ang isang maliit na bata na napapalibutan ng matinding pagdidilim.

15. Aalis siya sa makalawa ng umaga.

16. Ano pa ho ang kailangan kong gawin?

17. Kung may tiyaga, may nilaga.

18. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

19. Hindi pa rin matukoy ng mga pulis kung sino ang salarin sa pamamaril sa opisina.

20. Oo, malapit na ako.

21. The stock market can provide opportunities for diversifying investment portfolios.

22. Ang mga kundiman ay patunay na ang pag-ibig ay may lakas na magdulot ng ligaya at kalungkutan.

23. Till the sun is in the sky.

24. Some people view money as a measure of success and achievement, while others prioritize other values.

25. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

26. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

27. Halika, i-recharge natin ang baterya mo.

28. Iyon pala ay isang diyosa na nagpapanggap lamang.

29. Einstein's ideas challenged long-held assumptions about the nature of space and time.

30. Bakit lumilipad ang manananggal?

31. At sa kanyang paglayas, naligaw siya sa gubat at inatake ng maraming alamid.

32. Biglang bumangon ang hari at hinugot ang espada.

33. May notebook ba sa ibabaw ng baul?

34. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

35. The bank approved my credit application for a car loan.

36. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

37. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

38. Has he started his new job?

39. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

40. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

41.

42. I am absolutely committed to making a positive change in my life.

43. Pinagsulat si Jayson ng pangungusap sa pisara.

44. The weather is holding up, and so far so good.

45. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

46. The sound of the waves crashing against the shore put me in a state of euphoria.

47. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

48. Pare-pareho talaga kayo mga babaero!

49. Danmark eksporterer også en betydelig mængde medicinske produkter.

50. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

Similar Words

popularize

Recent Searches

makahingipopularhehebuslomahahabakwebamangingisdasinkbinulonginulitcasabeginningcleandollaritimbulsaagesumapitmakilingataquesgagambaayonalinmasasayarawginaganoonilocosrevolutioneretnaguguluhanpaanongkwartoparaisokagandahankaaya-ayangbayaranmakelossestablishmaunawaancomunicantwitchpinagbubuksanpamilyaavanceredenaaksidentehouseholdpalasyoplantaspagmasdansteamshipsbahasumalakayseparationprosesoheartbeatpollutioniniinompriestalapaapdarkhumaloumiyaknakataaspasyentekomedormagbibigaykumustalinapampagandamaghatinggabiampliakatagangduguanlumbaypesostuloynatapospulangsundaegardenmagigitingbalatnasangameskamustaandresmerchandisenakapamintanatinanggalnaabotnakarinigika-50tradisyonpaligsahantog,serioussiniyasatbinuksanleaderskinasisindakancourtpagdudugonakatulogkalayuannagmistulangmaliksipahahanappumapaligidnagbuntongpaniwalaanmagsusunuranlumiwanagsakopbiocombustiblesikinagagalakmagsasalitanakakasulatliligawannakalagayhesukristopagngitinagtutulaknapapag-usapanlumalangoytatlobukassignalpinalalayasvidtstraktnasaanmagsungitmamitasstorynakararaannaglulusakpesolalombricossukatin1970scontroversyforskelaregladoinventionpalapagtanawkakayananpakisabibinibilangdumikitelenasumimangotgurobobotoadecuadoisinumpaimprovementorderinbingolugarmukabilisofautilizarmagtipidhugis-ulokulaywalisguardamesangmayoritoconnectingmagdaburgerramdamresortinorderpeacetransmitidasnagsalitadalawanoblecelularesdedication,cornersbuwaleeeehhhhriskdemocraticboyetboteipinasulinganmoreluistabiwalletworrycongrats