Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

2. Ayaw ng kaibigan ko ang mainit na panahon.

3. Tinanong ng guro kung mayroon kaming mga katanungan ukol sa aralin.

4. Nanalo siya sa song-writing contest.

5. Matagal na napako ang kanyang tingin kay Kano, ang sumunod sa kanya.

6. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

7. Di ka galit? malambing na sabi ko.

8. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

9. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

10. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

11. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

12. Ang mga parangal na natanggap ng atleta ay nagpapakita ng pagpapahalaga at itinuring na tagumpay sa kaniyang larangan.

13. Up above the world so high

14. La persona ebria en la calle está llamando la atención de los transeúntes.

15. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

16. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

17. Hindi ko maaaring payagan ang aking mga agam-agam na hadlangan ang aking mga pangarap.

18. Nagulat ang magkasintahan nang biglang dumating ang pamilya ng lalaki para sa pamamamanhikan.

19. Football players must have good ball control, as well as strong kicking and passing skills.

20. Umalis siya sa klase nang maaga.

21. The cake is still warm from the oven.

22. Ang doktor ay pinagpalaluan ng kanyang mga pasyente dahil sa kanyang husay sa pagpapagaling.

23. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

24. Alam ko na mayroong magandang intensyon ang kanilang plano, ngunit hindi ako sang-ayon dito kaya ako ay tumututol.

25. Los bebés recién nacidos tienen un olor dulce y tierno.

26. Ang aming koponan ay pinagsisikapan na makuha ang kampeonato sa darating na liga.

27. Sa ikauunlad ng bayan, disiplina ang kailangan.

28. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

29. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

30. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

31. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

32. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

33. Sa soccer, sinipa ni Andres ang bola papasok sa goal.

34. For nogle kan fødslen være en åbenbaring om styrken og potentialet i deres egen krop.

35. Sa takipsilim naglalakad ang matanda sa tabing-dagat.

36. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

37. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

38. Babasahin ko? medyo naiilang kong sabi.

39. Natawa sya, Nakakatawa ka talaga. haha!

40. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

41. El amor todo lo puede.

42. I always feel grateful for another year of life on my birthday.

43. Tengo muchos amigos en mi clase de español.

44. The children do not misbehave in class.

45. The project is on track, and so far so good.

46. Ang sugal ay naglalayo sa mga tao sa kanilang mga responsibilidad at mga mahahalagang gawain sa buhay.

47. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

48. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

49. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

50.

Similar Words

popularize

Recent Searches

popularpasensyanahihilochickenpoxkatapatitutolindustryaumentaralaalapakealamfriendspogistokwebausolettermrstransmitidassuprememangingisdaiatfnakikitangkananbroadbroughtbangdiamondramdamomgmasdansufferjokebilingoliviabugtonghydelsorespeechesbabaehamakmatindingdulachamberspartnerstuffedpakpakdahonsamuunofencingmotionsimplengonlyaiddosnerissapowerskakayananshiftmalakingexperience,technologicalelectgoingreffeedbackadvancedpagkabuhaypatutunguhanagwadorprodujoninanaismasinopnagagamitsalbahengsayawannatabunanautomatiskpakinabanganpatakbongsinehanmensplanning,paketeincredibledespuesmagnifynapapatinginlabinsiyamtiningnanpublishing,matigassedentarypinyapssssigloiyonbumitawkamakailanpaksainantaynaggalaipatuloynakatingingparangpebrerobarrocopopularizepaskorosariomatagalirogmoodfuelnilanggreenhitbuscigarettemagasinconstitutionthoughtsibabadyipnagbabalanakataasclientesupportlungkotpagkaimpaktosalamangkerokahirapanitinaasbasketballnamataypamilyanatatanawawardnakalabaspaumanhininferiorespagtangispakikipagbabagmahiwagaestasyonhonestotumatanglawkinasisindakanmensahehumanspamagatkulunganharapanhagdananmarketing:hahahagermanyhistoryledlisteningsementongsilid-aralanpapalapitpaaralan1970slumiitbayanipaygayundinunconstitutionalnakapikitctricasflamencoeleksyonbagamaadditionally,patayiskedyulpaghunigoshlifeklasrumtrackreservationeksaytedbulaetopinabayaanmakawalaroomreading2001freddecreaseaggressionhellodibapaki-translatenagreklamoexhausted