Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

2. Ang kagandahan ng sunset sa beach ay animo'y pagpapahinga para sa kaluluwa.

3. Microscopes are commonly used in scientific research, medicine, and education.

4. Late ako kasi nasira ang kotse ko.

5. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

6. A picture is worth 1000 words

7. Inalagaan ito ng pamilya.

8. Nagtatanim siya ng mga gulay at nanghuhuli ng mga hayop sa gubat upang kanilang pagkain

9. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

10. The police were searching for the culprit behind the rash of robberies in the area.

11. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

12. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

13. I love to eat pizza.

14. Lakad pagong ang prusisyon.

15. Go on a wild goose chase

16. Bukod pa sa rito ay nagbigay pa ito ng bitamina sa katawan ng tao.

17. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

18. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

19. The actor received a hefty fee for their role in the blockbuster movie.

20. Sa mga mahahalagang desisyon, nagkakasundo kami bilang magkabilang kabiyak.

21. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

22. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

23. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

24. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

25. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

26. I admire my mother for her selflessness and dedication to our family.

27. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

28. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

29. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

30. The United States has been involved in many international conflicts, including World War I and World War II.

31. Les patients peuvent avoir besoin de soins psychologiques pendant leur hospitalisation.

32. Masayang-masaya siguro ang lola mo, ano?

33. The uncertainty of the future can cause anxiety and stress.

34. My co-workers organized a surprise birthday party for me at the office.

35. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

36. Ang mga pangarap natin ay nagbibigay sa atin ng inspirasyon upang magtrabaho nang husto.

37. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

38. Investing refers to the process of allocating resources with the expectation of generating a profit.

39. Naglipana ang mga isda sa malalim na bahagi ng dagat.

40. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

41. Nagitla ako nang biglang may lumabas na ahas mula sa mga halamanan.

42. Ano ang gustong palitan ng Monsignor?

43. Las redes sociales son una plataforma para compartir fotos y videos.

44. Naku, may boyfriend ako eh. sabi ko.

45. Marami rin silang mga alagang hayop.

46. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

47. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

48. Kumakain sa cafeteria ng sandwich.

49. Los powerbanks son una solución práctica y conveniente para mantener los dispositivos electrónicos cargados cuando se está fuera de casa.

50. Gumising ka na. Mataas na ang araw.

Similar Words

popularize

Recent Searches

lumilingonpopularsasakyankabutihanrosaalasinvesting:nasanami-missanotherbagkusnapadpadfollowing,ipanlinisgisinghearkamatisasulmalapadbatosabihingtuwangpolostaplemasseshehehidingpilitayonhintuturohinanapperocreatingnaupoopgaverorderinhilingbaroipatuloybutihingsnaarbejdermakasarilingmakesumayabalancesanayvalleybeginningsdinanasbinasanapakahusayreplacedjeromechangemajordatinamingcoaching:imaginationitaksumasambafridaybillkalannuonsumindiexplainrolebelievedsaudimatamisparticularknowartificialoperasyonreportgrabefacilitatingtipidrolledjoynagtuturomatandanameresultbubonggametripmakakatalolookedmagpapabunotmakamitleadaddingthreeeffectipinalitinternalbroadcastsincreasesteerrelievedbless1982metodehawlaprotestanagpatuloyhabangnagtataaskingdompandidiridugolumuwasbesidesenglishnaghubadniyomahahabangbumabaginsektongfar-reachingpropesorfreelancerandyankailanjosienabigaypaki-drawingnilangmalisannakatuwaanginvolveumaagosflexiblepag-aralinhistoriaituturolayuninnapapasayasallymagpalibrenakakapagpatibaytumatawadkinagagalakpagongtrenmatiwasaycoughingtilskrivescancernaiinitanipakitaninonglinta1920snakatulogactualidadprocesosueloinalislightsbio-gas-developingcoachingdinidahonauditpookyanwellbookbipolarthenbiromapaikotcebunanahimikdapit-haponnagmamadalinagkasunogalas-diyespagpapasanpagkakamalipapagalitanmerlindanakalagaymakangitikikitanakapagreklamoposporoanibersaryopagpasensyahannagpapaniwalanagtitiismawawalapinamalagitravelkamakailankabuntisan