Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Juan siempre espera el verano para cosechar frutas del huerto de su abuela.

2. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

3. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

4. El agricultor utiliza técnicas de riego para asegurar el crecimiento óptimo de sus cultivos.

5. Pinigilan nya ang mga kamay ko, Wag!

6. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

7. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

8. Amning er en vigtig del af den tidlige babypleje.

9. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

10. Akin na cellphone mo. paguutos nya.

11. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

12. Ano-ano ang mga nagbanggaan?

13. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

14. Minsan, nagulat ang pamilya sa pagdating ni Roque dahil may kasama itong lalaking may sugat.

15. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

16. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

17. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

18. Ngumiti lang sya, I know everything, Reah Rodriguez.

19. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

20. It takes one to know one

21. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

22. Namnamin ang bawat minuto kasama ang iyong pamilya.

23. Wala nang iba pang mas mahalaga.

24. She was born on June 26, 1993, in Boca Raton, Florida, USA.

25. Mahalaga ang pagtitiyaga sa bawat bagay na ating ginagawa, datapapwat ay may mga pagkakataon na hindi natin nakukuha ang inaasahan nating resulta.

26. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

27. Humigit-kumulang sa tatlong daan taong namalagi sa Pilipinas ang mga Kastila.

28. Naglalaro ang walong bata sa kalye.

29. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

30. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

31. The king's role is to represent his country and people, and to provide leadership and guidance.

32. Bumalik siya sa Pilipinas kasama ang suporta ng mga Amerikano noong 1898.

33. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

34. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

35. Sa tuwing Undas, bumibisita ang mga pamilya sa sementeryo upang mag-alay ng mga dasal para sa mga yumaong kamag-anak na maaring nasa purgatoryo pa.

36. Sumakay kami ng kotse at nagpunta ng mall.

37. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

38. Claro que entiendo tu punto de vista.

39. Isang araw, ang katulong ng bagong Sultan ay humahangos at ibinalitang may isang punongkahoy na tumubo sa kinalilibingan ni Sultan Barabas.

40. Mabait na mabait ang nanay niya.

41. Walang huling biyahe sa mangingibig

42. Ang ganda ng bagong laptop ni Maria.

43. Ang mensahe ay ibinigay ng isang misteryosong lalake.

44. Nagpasya akong tumigil at magpahinga nang magdidilim na ang paligid dahil sa sobrang pagod.

45. Pneumonia is a serious infection that affects the lungs.

46. He applied for a credit card to build his credit history.

47. Gawin mo ang nararapat.

48. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

49. Nakita rin kita! ang sabi niyang humihingal

50. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

Similar Words

popularize

Recent Searches

popularpaglulutohugisnicopabalangalexandersolarbigotesipatumulongonlinepinatutunayantiketwarinatakotpookipinikitalamtheymuchasmarsosoontelangdalawkerbisugabobogrankomunidadklimataga-hiroshimamagsasakahinimas-himasgalitanimomaaringlarrypabulongnathanmadeideyadaanhatinggabiheydragonmabutinghalikanauthordrewilanthereforepaslitpdafacilitatingexithalaganiceangkopfeedbackpuntajohngotorasattackerrors,nagpagawaeuphoricydelsercomputermesalongknowledgereportamongsumusunodpagguhithimayinulanderbultu-bultongmagalingglobalisasyonsapagkatsamupyscheenergypagtutolyesopisinanalugibiyasitinuturingnangumbidapuwedengforskelligelumakasgrammarwerepagnanasakabiyakformatreturnedkakataposdatapuwamournedyourricananinirahanwifibinigaydelelittleniyonefficientmakulongkaysalearningtulisanmagbasasugataraw-arawsinunodmataotalinobasedmarinigdumapalosspagnagitlakinalimutanmasayang-masayasamadustpanisisingitlagaslasnasaktanbunutankapenagsusulathierbasjaysonhinahanaphiyasuccessandroidmealhalamanankondisyonmaskinatayodiagnosticbahay-bahayisinuoteffektivestateredigeringnapilitanspendingmapadaliouttiniradorbalancesbayaanincomemuchbowlsystems-diesel-runpananakotkatagalanmaliksikinabubuhaymorekundidalawaprogrammingpaggawanyannaririnigmagingmanakbosupiliniconsbumibitiwnagsimulapaglisankapwafauxkabuhayansumalakayinathreemagkaibigankumatokpinag-aralanpansitblogperotumitigilmukah