Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Maliksi siyang lumapit at binatak ang bata sa liig.

2. Di ko rin alam kung ano na nga bang nangyayari.

3. Il peut y avoir des limites d'âge pour participer aux activités de jeu.

4. Lalong nag-iyakan ang dalawang bata.

5. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

6. Pinakain ni Fia ang aso ng dog treats.

7. Naputol yung sentence ko kasi bigla niya akong kiniss.

8. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

9. Pumulot siya ng mga bao ng niyog, gamit na panggatong sa apoy, at hinagis sa lola.

10. Promise yan ha? naramdaman ko yung pag tango niya

11. If you quit your job in anger, you might burn bridges with your employer and coworkers.

12. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

13. Ako muna sabi, e, giit ni Ogor.

14. Risk tolerance is an important factor to consider when deciding how to invest.

15. Anong klaseng sinigang ang gusto mo?

16. Maghanap tayo ng mga kabibi sa tabing-dagat.

17. Di na ako magtataka dahil alam ko naman ang nangyari.

18. The patient was discharged from the hospital after recovering from pneumonia.

19. Members of the US

20. Nagsine kami kamakalawa ng hapon.

21. Television has a long history, with the first television broadcasts dating back to the 1920s

22. Ipabibilanggo kita kapag di mo inilabas ang dinukot mo sa akin.

23. Ano ang nasa kanan ng bahay?

24. Si quieres que la comida esté picante, agrega un poco de jalapeño.

25. At blive kvinde kan også være en tid med forvirring og usikkerhed.

26. Si Juan ay nadukot ang cellphone dahil sa isang magnanakaw sa kalsada.

27. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

28. Ang bagal ng internet sa India.

29. Hindi pa nga ako nagtatanghalian eh.

30. Napadungaw ang ina at kitang-kita niya ang pagkasubasob ng anak bago paman ito nakaakyat ng hagdan.

31. You're not being direct. Stop beating around the bush and just say it.

32. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

33. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

34. Sadyang mapagkumbaba siya kahit na siya ay mayaman.

35. Inutusan niya si Pinang na magluto ng lugaw.

36. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

37. Kumain kana ba?

38. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

39. Dalawa ang kalan sa bahay namin.

40. Puwede bang makausap si Clara?

41. Los fertilizantes orgánicos son utilizados en el cultivo ecológico para enriquecer el suelo.

42. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

43. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

44. Está claro que necesitamos más tiempo para completar el proyecto.

45. Nag tinda si Aling Pusing ng isda upang may makain ang kanyang mga anak.

46. Tradisyon na nang mga Pilipino ang pagsisimbang gabi.

47. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

48. The presentation was absolutely flawless; you did a great job.

49. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

50. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

Similar Words

popularize

Recent Searches

popularbukasgitnaniyataon-taonpaligsahanprocesokalayaanreservednatapossinghalicontengatumutubomaubosmartialsiyangfuncioneshalaganagliliwanaggaanomalakinghagikgikkurbatanapatunayansiyudadpumapaligidbinibiyayaandahilmaibigaynangyaripangalananak-pawisovertypesmaaringtiniradormagpakasalnag-away-awaycarbonnadamanahihirapanrosetinakasanglobalisasyonpagtatanghalkakaibangpagdiriwangkasamaangpupuntasinabigulatkatagapangungusaphumahangoscultivokagyattumatakboninapahinganatagalanhistorycompletingifugaonaglutokatiepulismakatarungangsumisiddomingoalas-dosepaghangaentertainmentmasaksihancivilizationnaguusapbansangmag-amasumayawkaibiganumalishetokumaripasatehumampashimutokturismopagkakamalibitbitkotsetaingananonood1935kapaldesigningpookpangkaraniwangtoolspagsasayadivisoriatalentdoublehinamakmatandapalagaykamijuanadesarrollaronadditionallybinabalikpinatiracaraballofridayconnectnatutulogtillheldmarangalgeologi,marinigpanabutololamaglalarosarapinantaymagtataposibilinagpuntahansalbahegrowthnanlilimahidpabilimagsasakaperoisdaterminodaddydivisionkalalarodahan-dahanpisitanawnamulaklakhirapkananctricasvivasalamangkeraconnectingngangmaayosmatarikrosasasamasariwabanalpagawainkulogpabalingatalisjenytubigaddictionanakumampipag-aalalaanungmagbagong-anyomuchamartesexpertbarangaypagkakayakappoolstayfarmaghaponnapatakboumiinomnawalansumahodinorderbituinbuhaymaanghangletsatisfactionnapakalakaspaskokailanmananumanpasalubongawareinfluencecallermasakitmatagal-tagalikinamataymakapaniwala