Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. La physique est une branche importante de la science.

2. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

3. Maaaring magbigay ng libro ang guro sa akin.

4. She has started a new job.

5. Ang mga lugar na madalas tamaan ng buhawi ay kailangang magkaroon ng mga pinalakas na imprastruktura at mga hazard mitigation measures.

6. The foundation's charitable efforts have improved the lives of many underprivileged children.

7. Si Mabini ay naglingkod bilang siyang "Brains of the Revolution" noong panahon ng himagsikan.

8. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

9. The pneumonia vaccine is recommended for those over the age of 65.

10. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

11. The event was sold out, and therefore we couldn't get tickets.

12. May bago ka na namang cellphone.

13. El arte callejero es una forma popular de arte urbano.

14. El graffiti en la pared está llamando la atención de la policía.

15. Ilan ang tao sa silid-aralan?

16. Madali naman siyang natuto.

17. Football players must have good ball control, as well as strong kicking and passing skills.

18. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

19. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng kaguluhan at kalituhan.

20. "Laging maging handa sa anumang sakuna," ani ng opisyal ng gobyerno.

21. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

22. Ano ang pangalan ng doktor mo?

23. Have you tried the new coffee shop?

24. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

25. She has been baking cookies all day.

26. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

27. Ang dami daw buwaya sa kongreso.

28. I finally finished my degree at age 40 - better late than never!

29. Dumating ang bus mula sa probinsya sa hatinggabi.

30. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

31. Nagluluto si Tess ng spaghetti.

32. Naalala niya ang itinuturo ng misyunero na si Hesus daw ay muling nabuhay pagkalipas ng tatlong araw

33. Mas mainit sa Pilipinas kaysa dito.

34. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

35. Kalaunan, pati ang tanim ng may tanim ay lihim nitong sinisira.

36. Sa harapan niya piniling magdaan.

37. Ano ang nasa bulsa ng bag niya?

38. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

39. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

40. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

41. Sa aling bahagi ng pelikula ka natawa?

42. Instagram is a popular social media platform that allows users to share photos and videos.

43. Scissors are an essential tool in classrooms for art projects and cutting paper.

44. Ang paborito niyang laruan ay Beyblade.

45. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

46. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

47. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

48. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

49. Nous avons choisi un thème de mariage champêtre.

50. Ano ang nasa ibabaw ng palayan?

Similar Words

popularize

Recent Searches

popularnakajocelynedsacarbonsoundmataraylimitedkabosespangingimiitinagotapatnakapuntacelularesgraphicresumenmininimizecassandradogsfeltnatanggapbinibiniasulelitemaglegendsenatewalngseriousnumerosassinongrichlabingvotesnitongwidespreadreducedulamerapbilinkamatisclassroombibigyanmamalasexigentepagbabagong-anyogoinginitaraw-araweskuwelahantungopetroleummateryalesafternakakagalatumalonkasakitnatagalanmeaningkinalakihannagkwentotatagalunti-untinananaghilipedeiyanevolvedjunjuntabadulospreadcompletededicationnotebookfourdeclarereadinggagawinkinauupuanbinibiyayaannananalocultivarpagtatanongclubpodcasts,posporohawlaimagesmagbigayannatulogmabaitkumbentosinakopexpresanothersgymbuwayamakapangyarihannagliliwanagnagngangalangikinatatakotnamumulaklaknakikini-kinitatubig-ulannakatagokanikanilangkabuntisantatayopinaghatidanpinag-aaralannamumutlabiologidumagundonghanapinipinabalikhanbriefpagtatanimistasyonmensahemagkasamapresidentepahirampinakidalamatagpuantumatanglawpalancasiguradomaglaromarketing:umigtadpakinabanganre-reviewpatakbonanunuksokolehiyokanluranniyogemocionesnakisakaybinge-watchingkampanakumanangelainagsamanasaangnanangisbinabalikbatok---kaylamigbutasmariegownflamencoanubayannanoodbayangagostolalimmagdilimboyfriendanteseroplanosigurosasapakinprotegidodescargarpabilisteamshipstuyoalamidassociationkelanrosellelinawkananwastesalatkarapatankauna-unahangsinipangsamfunddoktornam1876joshpitoipinadalahehemakaratingperangsorryreservation10thcuentanspecialipagbilimatchingtonleytegiyera