Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

2. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

3. Ingatan mo ang cellphone na yan.

4. Malamang na tamaan ka pa ng kidlat.

5. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

6. Dahil sa magandang boses at musika, nahuhumaling ako sa panonood ng mga musical plays.

7. He teaches English at a school.

8. Napupuno ako ng poot sa tuwing naaalala ko ang mga pagkakataon na ako'y pinagtaksilan at sinaktan.

9. En algunos países, las personas solteras celebran el Día de San Valentín como el Día del Soltero.

10.

11. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

12. She studies hard for her exams.

13. They have been friends since childhood.

14. Ha? Ano yung last na sinabi mo? May binulong ka eh.

15. May luha siya sa mata ngunit may galak siyang nadama.

16. Kung anong puno, siya ang bunga.

17. Dahil malilimutin ako, nakalimutan ko na naman ang pangalan ng bagong kaklase.

18. Sinundan naman siya ng mga magulang niya.

19. Mabuhay ang bagong bayani!

20. Masama pa ba ang pakiramdam mo?

21. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

22. Hindi ninyo madadala sa hukay ang yaman ninyo.

23. How I wonder what you are.

24. May biyahe ba sa Boracay ngayon?

25. At blive kvinde kan også være en tid med forvirring og usikkerhed.

26. My boyfriend took me out to dinner for my birthday.

27. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

28. Naging mas makapal nga ang buhok ni Rabona.

29. Maraming lumabas na balita ukol kay Pangulong Manuel L. Quezon.

30. Kumusta? Ako si Pedro Santos.

31. Sa tuwing nagkakasama kami, nadarama ko ang walang hanggang pagmamahal ng aking kabiyak.

32. También fue un innovador en la técnica de la pintura al fresco.

33. Botong boto sa kanya ang mga magulang ng kanyang kasintahan.

34. A microscope is a device that uses lenses to magnify small objects.

35. Hindi siya makapaniwala kaya sinalat niya ang kanyang mukha.

36. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

37. Ani niya, wala nang makakatalo sa kanyang kakayanan.

38. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

39. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

40. Magandang umaga po, mga mahal na manonood.

41. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

42. Pneumonia can be prevented with vaccines and by maintaining good hygiene.

43. Hindi ako komportable sa kanilang plano kaya ako ay tumututol.

44. Si Emilio Aguinaldo ang unang pangulo ng Republika ng Pilipinas.

45. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

46. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

47. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

48. Ang trahedyang naganap sa kanilang komunidad ay nagdulot ng pangmatagalang lungkot sa kanilang mga puso.

49. The website's design is sleek and modern, making it visually appealing to users.

50. Nais ko lang itanong kung pwede ba kita ligawan, kasi sa tingin ko, ikaw ang gusto kong makasama.

Similar Words

popularize

Recent Searches

sigepopularryannagliliwanagkinatatalungkuangnapakamisteryosobaku-bakongencompassesnakakamanghapangalannagkakatipun-tiponsaanmaayoshampaslupasalapianak-pawismakikipagbabagnagkakasyapagpapatubonangampanyapresidentialhinipan-hipanmerlindamumurakinatatakutankinamumuhiananibersaryohahatolmagulayawnalugmokpamilyangpinapasayalabing-siyamnasasabihanpinaghatidannakahigangnagkwentopagkahapokapatawaranmakahiramnakakagalatobaccotiniradornagpaiyakalikabukinpagpapasansimbahannagpipikniktaga-tungawnovellestemparaturapaciencianakatindignakatagotatayotinutopkalaunankuwadernomagkakaroonsharmaineisinuotadgangpagsagotasignaturakaklaseilalagaykaramihantumakasnakakainlinggongpagamutannagbagonagsamakisapmatapicturescanteennatatawafysik,taga-ochandoumigtadpaospakukuluaniniirogdecreasedbihirangkarapatangguerrerotumingalanakauslingkampanahinanakittig-bebeintecombatirlas,sunud-sunodpanaypananakitalangandescargaraayusinmensmaskinerkalabannaawadisensyonangingisaybighanivaliosamakapangyarihangpokergloriagasmenabutanpangalananresearch,songsnapabumagsaknahantadbutterflyrequierenlihimnahulogmariemaatimkambingpulitikoatensyonomfattendee-commerce,siratelabarangayisipespigastradeblazingibonlinggomeaningradioailmentsdemocracygoshanaybritishlandaskasakitcnicofatherindividualsaddictionantokmartialsistercarolhimayinkasamapaldatsemawawalakakataposkasinggandakuwartaaudiencesignkaarawanapoymagbigayandissevetomayamanplasadumaansalatpuwedeprimerrabepolodoktorpartygrewbecomeclientspinatidibignagdaramdaminantokkitangbarrierspocacafeteriathenitaksinipangbatomallbatileukemiarhythmstar