Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. La realidad es que a veces no podemos controlar lo que sucede.

2. Sa kanyang paglalakad, napadungaw siya sa isang tindahan ng kakanin at napabili ng puto.

3. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

4. At vedligeholde en regelmæssig træningsrutine kan være udfordrende, men belønningerne for ens sundhed og velvære kan være betydelige.

5. Sa pamamagitan ng pag-aaral ng mga relihiyon, mas naging bukas ang aking kamalayan sa iba't ibang paniniwala.

6. Ang mga punong-kahoy ay hindi lamang maganda

7. Bale, Wednesday to Friday ako dun.

8. Nakabili na sila ng bagong bahay.

9. Sa tuwing nagkakasama kami, nadarama ko ang walang hanggang pagmamahal ng aking kabiyak.

10. Malapit na ang araw ng kalayaan.

11. Leonardo da Vinci nació en Italia en el año 1452.

12. Hinawakan ko na lang yung pisngi niya. Matulog na tayo.

13. Anong klaseng karne ang ginamit mo?

14. Nag-aaral siya sa Osaka University.

15. Sa baguio nila napiling mag honeymoon.

16. Anong bago?

17. Some fruits, such as strawberries and pineapples, are naturally sweet.

18. Many people go to Boracay in the summer.

19. I love you, Athena. Sweet dreams.

20. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

21. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

22. Amazon has a reputation for being innovative and forward-thinking.

23. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

24. Inflation kann auch die Sparquote verringern, da das Geld weniger wert wird.

25. Mayroong mga bayani na hindi kilala ngunit nagawa nilang magpakumbaba at maglingkod sa bayan.

26. The exhibit features a variety of artwork, from paintings to sculptures.

27. Sí, claro, puedo esperar unos minutos más.

28. May naghubad na ng damit at isinampay na lamang sa balikat.

29. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

30. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

31. Les astronomes étudient les étoiles et les galaxies.

32. At siya ang napagtuunan ng sarisaring panunukso.

33. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

34. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

35. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

36. Pinanood namin ang Ifugao kahapon.

37. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

38. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

39. John Adams, the second president of the United States, served from 1797 to 1801.

40. Gusto ko na talaga mamasyal sa Singapore.

41. Kahit mahirap ang buhay noon, nagsumikap si Carlos Yulo upang maabot ang kanyang mga pangarap.

42. Uuwi si Ellen sa Cebu sa Pasko.

43. Ano ang ginawa ni Trina noong Pebrero?

44. Limitations can be perceived or real, and they can vary from person to person.

45. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

46. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

47. Hindi niya alam kung anong uri ang halamang iyon.

48. Ang pagtangkilik ng musika o pagtugtog ng isang instrumento ay isang nakagagamot na karanasan na nagbibigay ng ligaya sa aking puso.

49. It was founded in 2012 by Rocket Internet.

50. Nakatuwaang kainin ng mga bata ang bunga.

Similar Words

popularize

Recent Searches

populartiningnankaarawanlapatmalakaspangakomaagamapapamaitimrhythmnahulitablerobertallowedpacekapagpinagbigyaniloiloduguanbinitiwangataskitainiangatkonsyertolunasibilijenautakelektronikseepasigawhoteltumatanglawtalanapawimahahanayrevolutionizedmeriendasentimoskinakabahansakristanmanghikayatambisyosangmataletterjunebakanotnamumutlanagsuotgabekagipitanpinangyarihansasamahankaparehanagwalisano-anokinakailangangtotoowastotinutopbukasnapagtantoipinagbibililapisdalhanpinilitnanoodsisipainsonbutoipipilitbienasosnaelvisreservessufferverynaiinggithistoriahiramhinamakdireksyongubatsiyudadlolapag-iinatanimalisanyoutubepinakamalapitbayawakculturepaki-drawingnalugmoknagliwanagmakatatlowalkie-talkiekategori,oktubrebloggers,pagkaimpaktonagsasagotnagpapakainnanghihinakasaganaantinatawagsalamangkerorabbaalamidkalakimakakibomasasayalumakasmawawalamahinangstrategieshahahapaiddadalawamericaintramurosmakakabaliknagdabogvillagesampungtusongnuevosnaglabatsinavitaminnangingisayenviarlalocupidtumabapayongampliaantesbiyernespayapangumabotmassachusettsmaghahandaadecuado1960siguhitrepublicanjagiyaglorianababalotsakayejecutanpagkatcarolalakenerosabogstreetbiyasumalisbecameteacherbehalfkarapatandiyospebreronataposiskedyulyakapmaistorbokahusayancarlodinanastrennunopriestmalakiareasipinasyangsetyembrevehiclessuccessfulredigeringdiagnosesfonoscapitalnoblebeerbibigbabasahinhearcompostelabuwanreboundbecomingcenterbarrocohacer