Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

2. Marami siyang kaibigan dahil palangiti siya.

3. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

4. Nasa akin pa rin ang huling halakhak.

5. Musk has faced controversy over his management style and behavior on social media.

6. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

7. Los padres pueden prepararse para el nacimiento tomando clases de parto y leyendo sobre el proceso del parto.

8. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

9. Papunta na ako dyan.

10. Kasama ko ang aking mga magulang sa pamanhikan.

11. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

12. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

13. Obvious. tawa nanaman sya ng tawa.

14. The culprit behind the data breach was able to exploit a weakness in the company's security.

15. Maaari po bang makahingi ng sobra sa hapunan ninyo?

16. Sa paligsahan, ang pinakamataas na saranggola ang nanalo.

17. Puwedeng hiramin mo ang aking laptop habang inaayos ang iyong sarili?

18. Today, Amazon is one of the world's largest online retailers.

19. Dogs can provide a sense of security and protection to their owners.

20. Put all your eggs in one basket

21. I'm going to surprise her with a homemade cake for our anniversary.

22. Ang aking teacher ay hindi muna nagturo ngayong araw.

23. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

24. Lumitaw umano ang isang nawawalang antigong larawan sa isang auction sa ibang bansa.

25. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

26. Mabuti na lamang at hindi natuloy ang sumpa.

27. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

28. Magbibiyahe ako sa Mindanao sa isang taon.

29. Naaalala mo pa ba noong tayo pang dalawa.

30. Ang kalayaan ay hindi dapat magdulot ng pang-aabuso sa kapwa.

31. The dedication of parents is evident in the love and care they provide for their children.

32. Ang pusa ay nasa ilalim ng upuan.

33. I am absolutely impressed by your talent and skills.

34. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

35. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

36. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

37. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

38. Puwede bang makausap si Maria?

39. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

40. Les personnes âgées peuvent vivre seules ou avec leur famille ou dans des maisons de retraite.

41. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

42. Ang mga batikang mang-aawit at musikero ay karaniwang itinuturing bilang mga alamat sa larangan ng musika.

43. Some people argue that it's better not to know about certain things, since ignorance is bliss.

44. Masaya pa kami.. Masayang masaya.

45. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

46. High blood pressure is more common in older adults and those with certain medical conditions.

47. Ang tahanan ng mga ibon sa tabi ng ilog ay mayabong at nagbibigay ng malasakit sa kalikasan.

48. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

49. A lot of people volunteer their time and resources to help those in need.

50. Sa kanyang huling araw sa opisina, nag-iwan siya ng liham ng pasasalamat sa kanyang mga kasamahan.

Similar Words

popularize

Recent Searches

populardailynahuhumalingtagsibolfuemagdabairdmestlawspiecesfonosfreesantotonightjanemurang10thaaliscallerbaulboksingbatibisigpitakakwebangteamcurrentautomationwealthpasswordhomeworkluisdragonsumangcomplicatedcoinbasemabangoconsideredsoonhinagpisilangschoolbowstudiedcontinuespinalakingfascinatingkartonsedentarypublishingvasquespicturesnagtanghaliantabihanberkeleyrepresentativebilingremotebetweenmuchgenerabacreationadaptabilitymaghahandakukuhanakakatulongpunung-punomagpaniwalanadamabagnoonghouseholdsstrategieswantbibilhinbesessabogcomputeremakinangbinanggapagigingpagbigyanhetobingimangingisdaanimoprivateconditionnapakamotpanimbangkaklaseumiyakpaketefeltevnetrabajarmaaariipinafirstkakahuyaninilingselaobstaclesailmentsusonamulaklakkinagalitannapakahusaymagtanghaliannakasimangotnagtungonakakabangonnagbiyayaespecializadaskumakalansingnagbabakasyonngingisi-ngisingvirksomheder,nakakapamasyalgayunpamanmagbagong-anyopinakamahalagangkayang-kayangpagkakapagsalitaitofrescogagawinnagpuyosunahinnagsagawamahawaannapapasayaluluwasdisenyongnakapasokmagsi-skiingpinag-aaralanpinabayaankatawangtungawkapatawaranmanghikayatnag-poutnakatirangnagpatuloymahihirappupuntahannananaghilimagpaliwanagkapamilyapapagalitannaghuhumindiginaabutanpaglisant-shirtiintayinmasayahinmakidalomaliksitumatawagnagtataasnalakimawawalakasintahankasiyahaniloilomahahalikyoutube,maipagmamalakingpinamalagimagtataasmakuhangpinapaloyumabongpinuntahannakatulogpresence,nalalabingpagkainispandidirimahinogpagdudugonakakatandamontrealkahuluganpatakbomagdamagkommunikererculturaslamesamanilbihanalapaapkatutubonanunuksonagtataemagkasakitplatokondisyonhawaiinakataas