Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

2. Sa tamis na dulot ng pag-ibig natin dalawa.

3. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

4. May dalawang puno sa harap ng bahay namin.

5. Hinayaan kong lumabas ang malalim na himutok upang ipahayag ang aking galit.

6. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

7. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

8. Pakibigay mo naman ang libro kay Anna para magamit niya sa kanyang takdang-aralin.

9. Lumbay na naman si Jose matapos matalo sa sabong.

10. The ad might say "free," but there's no such thing as a free lunch in the business world.

11. Styrketræning kan hjælpe med at opbygge muskelmasse og øge stofskiftet.

12. Papasa ka kung mag-aaral ka ng leksiyon mo.

13. Selain agama-agama yang diakui secara resmi, ada juga praktik-praktik kepercayaan tradisional yang dijalankan oleh masyarakat adat di Indonesia.

14. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

15. Elektronik er en vigtig del af vores moderne livsstil.

16. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

17. Pumupunta ako sa Laguna tuwing Mayo.

18. La creatividad nos lleva a explorar nuevos caminos y descubrir nuevas posibilidades.

19. Kinuha ko yung CP niya sa bedside table.

20. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

21. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

22. Naglalagay ng bulletin board ang guro sa silid-aralan upang maipakita ang mga gawain ng mga estudyante.

23. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

24. Tumugtog si Jemi ng piyano kahapon.

25. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

26. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

27. Matapos ang pagtatanghal, bagamat di man lang siya makangiti at makatawa, kitang-kita sa kaniyang mata ang kasiyahan.

28. Kung hindi ngayon, kailan pa?

29. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

30. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

31. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

32. No dejes para mañana lo que puedas hacer hoy.

33. Ano ang natanggap ni Tonette?

34. The amount of knowledge that exists in the world is immeasurable.

35. Ang ganda ng swimming pool!

36. The flowers are blooming in the garden.

37. Gusto mong mapabuti ang iyong kasanayan? Kung gayon, magpraktis ka araw-araw.

38. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

39. Ang malakas na tunog ng sirena ay binulabog ang katahimikan ng lungsod.

40. Ang buntot ng saranggola ay mahaba at makulay.

41. Sumasakay si Pedro ng jeepney

42. Nagtatanong-tanong ako sa kanyang mga kaibigan upang malaman kung ano ang mga gusto at ayaw ng aking nililigawan.

43. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

44. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

45. His presidency was marked by controversy and a polarizing political climate.

46. Kucing juga dianggap sebagai hewan yang bisa membantu mengurangi stres dan kecemasan.

47. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

48. Saan ba? Wala naman ako allergy eh, palusot ko lang.

49. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

50. Bumabaha sa amin tuwing tag-ulan.

Similar Words

popularize

Recent Searches

popularmaibalikaksidentebarabaspahirapannagtagponanghahapdipinagkakaguluhanpang-araw-arawkasimamanugangingdiferentesginagawamaasahanhumalopangyayaringinakalapanatilihinmaglalaromaihaharappagsalakaymagkaibapakanta-kantangpagpasensyahanendvidereadecuadopinatawadnatakotnakainmanggamaibapananakitnamilipitflamencohigpitankakayanandivisoriaengkantadabibigyansugalandreatinutoppangalananmakuhangmakalabasiwinasiwassakristanhahanapinmahahanaynapatungomuraumiibigalituntuninmakauwikaninumannakahuglumakitumatanglawsharmainenabighanileksiyonfredparatingoffentligbreakhatingmunasharetipidpaldadinigagambayoutubeenglandpasasaansisipainkaybilisbagongkasingpitakahimutokbativitaminpinalutokulunganverypakelamsuedeasulbossmalasreservesnanggagamotnahintakutankaykalayaanwhethermais11pmreservationpetsangsnainteresttransmitsdeathattractivebuwalkatedralvotessumarapdyanresearch:sobraheheetogalingaddincreasinglylorenaluisinalalayanprovidemagbungaprosperexportmakapilingdumaramidriverfallarelevantnagpapanggapphilosopherreadingpotentialnag-usapharmfulnagmamaktolmaghaponsumimangotexigentedevelopedmagtipidpakisabinaglinisnaghihirapnakabibinginglumiwanaghotdogsuriinusabustonopinabilimaalikabokcovidingatansangalilipadkendibatokawaaudiencepresyopumatolopohonestocountlessmotionguiltylightsaidelectronicpagkakamaliochandonamulatnagtrabahopangungutyapinagsasabikinatatalungkuanglumakadthanksgivingnapasigawnapanooddeliciosanakapasokrebolusyonawitinmanghikayatsandwichcantidadumiwasiligtaspakistanbahagyapulislakadabanganjuankuwebagusto