Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. He has been to Paris three times.

2. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

3. Bakit sila makikikain sa bahay niya?

4. Sa halip na maghanap, sinalat na lang niya ang ibabaw ng mesa para sa relo.

5. Les travailleurs peuvent travailler à temps plein ou à temps partiel.

6. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

7. Mabait siya at nanggagamot siya nang libre.

8. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

9. Ang presyo ng gulay sa palengke ay mababa ngayong linggo.

10. Maaaring magbago ang ekonomiya ng isang bansa dahil sa digmaan.

11. Los héroes son ejemplos de liderazgo y generosidad.

12. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

13. Habang nagtatanim sila, tinatangay ng hangin ang mga buto palayo sa lupa.

14. Nais ko sanang magkita tayong muli dito sa halamanang ito mamayang gabi.

15. Sa ganang iyo, dapat pa bang bigyan ng pangalawang pagkakataon ang mga nagkasala?

16. Ano ang gagawin mo sa Linggo?

17. Maraming alituntunin ang ipinatutupad sa eskwelahan.

18. The model on the runway was a beautiful lady who effortlessly commanded attention.

19. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

20. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

21. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

22. Tinutukoy niya ang tarangkahan ng opisina kung saan sila magkikita.

23. It's a piece of cake

24. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

25. Heto ho ang isang daang piso.

26. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

27. Nasa Montreal ako tuwing Enero.

28. Nami-miss ko na ang Pilipinas.

29. Ano ang natanggap ni Tonette?

30. She is drawing a picture.

31. Adopting a pet from a shelter can provide a loving home for an animal in need.

32. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

33. Tumango tapos nag punta na kami sa may garden ng hospital.

34. Money can take many forms, including cash, bank deposits, and digital currencies.

35. Nagdiriwang sila ng araw ng kalayaan.

36. Ariana is an advocate for animal rights and follows a vegan lifestyle.

37. Bagamat sa Limasawa, Leyte nagdaos ng unang misa, may isang paring Kastilang nagngangalang Padre Novelles ang nakarating sa lalawigan ng Nueva Ecija.

38. Ano ang sukat ng paa ni Elena?

39. Lazada is an e-commerce platform that operates in Southeast Asia.

40. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

41. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

42. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

43. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

44. Laganap ang fake news sa internet.

45. Ang pagsasama ng pamilya ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

46. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

47. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

48. Si Andres Bonifacio ay isang magiting na bayani.

49. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

50. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

Similar Words

popularize

Recent Searches

popularibotobuksanstoppinuntahanjuliuspetsalapihinagiskaybilishigaanintokabuhayanjokesakitrememberedmaisipmalaki1990mismomakasakaytryghedipinikitbatok---kaylamighukaykaklasekauna-unahangformanakisakaynakukuhapagkainanimnahigasumalakaynamalagisorepneumoniapalibhasanakatitiyakalexanderpalagikumakantacalidadkundipagsalakaylinawphysicalumokaykinatatakutankalalakihanbobotomagkasinggandakulayanalysedalawaterminomalapaditinagoituturopulubiwastepagka-maktolbabalikcomunicarsetermnagliliyababamababawpintuantwo-partypagtangisniyonkakayurinkaysarapinisa-isaliablebigyankayyataelectionstieneskills,umakyatnakaangatkabosesganangbotonginformedpatpatbilangconventionalpaskokakayanangfirstbookpersonalbutmedicalwhichplatformsapagkatkumakapitpearlkakayananmagagawakungkumakalansingtandalagnatmessagepagkakayakapnakayukoperformanceintroductionnakalipasgawaibabawusinginaapipaghugosconectanpagsidlanmarahannapabreakgagamitincandidatesestasyonkakaininrimasiinuminconstitutiontumatawadmatipunosulatpakiramdampagkalapitmapalampaslangostaconstantlylalakadstruggledpapelsteerimaginationmanbilhinumanodemocracykabundukannanghingimagkasamaringkayapotentialmisyunerongmatabangjuniomakisuyoconditioningteambokservicesemailsapatoskapagsiyambalangclimabagodumilimconsideredpalakakagalakanmadamioperativosmagkakailameaningnilakalawakanmalungkotawitandumapanag-aagawanlabispookkapataganpapapuntaimikseveralibabanapadpadiyanmaninirahansumunodisinamametropakilagayherramientanutrients