Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

2. Magaling sumayaw ng Tinikling si Gabe.

3. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

4. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

5. Ang pagsisindi ng kandila tuwing gabi ay naging isang ritwal na nagbibigay ng katahimikan sa kanyang isip.

6. Anong tara na?! Hindi pa tapos ang palabas.

7. Siya ay laging nagmamalabis sa pag-aaksaya ng pera para sa mga luho.

8. The novel was a hefty read, with over 800 pages.

9. Agad na kinuha ni Mang Kandoy ang kanyang itak at tinaga ang mangkukulam.

10. Sa kabila ng kanyang tagumpay, may bahid ng lungkot sa kanyang mga mata.

11. The cough syrup helped to alleviate the symptoms of pneumonia.

12. My grandfather used to tell me to "break a leg" before every soccer game I played.

13. Ang biglang pag-alsa ng mga manggagawa ay binulabog ang industriya ng paggawa.

14. Nag-uumigting ang kanyang mga ugat

15. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

16. Medarbejdere skal ofte undergå årlig evaluering af deres præstation.

17. We celebrated their promotion with a champagne toast and a slice of cake.

18.

19. Hindi natin maaaring iwan ang ating bayan.

20. Nasa page 5 ang mapa ng Metro Rail Transit.

21. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

22. He does not waste food.

23. Mayroong mga bayani na hindi kilala ngunit nagawa nilang magpakumbaba at maglingkod sa bayan.

24. There were a lot of people at the concert last night.

25. Don't underestimate someone because of their background - you can't judge a book by its cover.

26. Sa balkonahe ng kanyang bahay sa Kawit, idineklara ang kalayaan ng Pilipinas.

27. Sadyang maganda ang panahon ngayon kaya't magpi-picnic kami sa park.

28. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

29. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

30. Parang ganun na nga babes. Tapos tumawa kami.

31. Twinkle, twinkle, little star.

32. Ate, gusto ko sanang mag-isa.. ok lang ba?

33. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

34. Inihayag ng mga empleyado ang kanilang mga mungkahi upang mapabuti ang mga proseso sa opisina.

35. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

36. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

37. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

38. A couple of lovebirds were seen walking hand-in-hand in the park.

39. Sino pa, isisingit ni Ogor, di si Dikyam!

40. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

41. Ano ang ginagawa mo nang lumindol?

42. Tatlong linggo kami dito sa Pilipinas.

43. Sa aking silid-tulugan, natatanaw ko ang ganda ng buwan na sumisilay sa bintana.

44. Paano ka nakapasok sa bahay kagabi?

45. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

46. Mahirap makipagkita ng basta-basta, kaya sana pwede ba kita makilala?

47. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

48. Di rin ako paulit-ulit ha! Di yan ang lagi kong sagot!

49. Mas mabuti pang magpakatotoo at huwag maging masyadong kababaw sa mga bagay.

50. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

Similar Words

popularize

Recent Searches

popularpaosconclusion,skyldes,magawatodasbiyernesproductionalanganbatobatikamotekapepare-parehoantoksilao-onlinetaglagaslalimbawathastapabilisumasambabilerestablishedfacultyslavebuntispunong-kahoykahirapanbumababaunopebrerotumigilandyanbilaohighintoibigvaliosainiirogmuchmaibalikdiaperlasingeroiikotpinakamaartengtabing-dagatgulangtabaaplicacionesbosesnagkantahannapahintomakakibospreadsignitinulosmacadamiajuegosmalakingpawischavithamaktrycyclemulingpinalakingmasteraudio-visuallygenerabacurrentsafecesnagsuotablebilibjobsbibilhinmagpaniwalapatunayanmaidanihouseholdsnagniningningvaledictorianconocidostipkagalakangracemahagwaymabigyantechnologymagdaraoscollectionsarbejderbakitb-bakitnunoisinusuotmakakalimutinculturesmulaligaligngunittutusindavaostayginagawapalakaistasyonpalabasawitinmagkaibanohtumatakbohagdanantiyanbumangontsenapapatungobiyasyatamalamangkanancynthiapapalapitkargangpamagatmahiwagalorenamabangisiguhitpinagkiskisnakatagoarawpaglalabadapasyentenerokinikilalangsamantalangpusaiconsharmaineganidpinagbigyanobservation,emocionantemerlindanaapektuhanganapinnakauwibesesnapanoodtv-showscourtmensahenegro-slavesproducerereconomickuwadernosumindimadurasmedya-agwahinilanaawainilistapakukuluantumagalkagabikasalukuyan1980hayaangpinagpatuloyipasokmarasiganspecializedyumakaparturonamumutlapopulationnaritolumiwanaglasaalamseektransparentipagbiliexhaustionmaisusuotleytebeingespecializadasmagtagonangapatdanbinasaheartbeatdakilangkinakainnagliliwanagproducts: