Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Huh? Paanong it's complicated?

2. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

3. "Huwag kang susuko," ani ng coach sa kanyang koponan bago magsimula ang laro.

4. Transkønnede personer har ret til at udtrykke deres kønsidentitet uden frygt for vold eller diskrimination.

5. The scientific community is working to develop sustainable energy sources to combat climate change.

6. Ang kanyang kwento ay hitik sa mga magagandang detalye at makulay na karakter.

7. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

8. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

9. May dalawang libro ang estudyante.

10. Da Vinci fue un artista renacentista muy importante.

11. They have been volunteering at the shelter for a month.

12. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

13. Sinundan naman siya ng mga magulang niya.

14. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

15. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

16. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

17. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

18. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

19. Lack of progress or slow progress towards a goal can also be a source of frustration.

20. Eksport af grøn energi er en vigtig del af den danske eksportstrategi.

21. Anong tara na?! Hindi pa tapos ang palabas.

22. Las heridas infectadas pueden requerir de antibióticos para su tratamiento.

23. The patient was discharged from the hospital after recovering from pneumonia.

24. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

25.

26. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

27. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

28. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

29. The cat was sick, and therefore we had to take it to the vet.

30. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

31. Ano ang ipinabalik mo sa waiter?

32. Isang araw, umuwing mainit ang ulo ng binatilyong apo dahil natalo sa sugal.

33. We admire the dedication of healthcare workers in the midst of the pandemic.

34. Sumulat ng tula ang aking guro sa aming klase at pinabasa sa amin.

35. Lumipad palayo ang saranggola at hindi na nila nakita.

36. Si Emilio Aguinaldo ang unang pangulo ng Republika ng Pilipinas.

37. O sige, ilan pusa nyo sa bahay?

38. Børn er en vigtig del af samfundet og vores fremtid.

39. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

40. Pedeng ako na lang magsubo sa sarili ko?

41. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

42. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

43. Nakatira ako sa San Juan Village.

44. Las plantas de interior son populares para decorar espacios dentro de las casas u oficinas.

45. La agricultura sostenible busca minimizar el impacto ambiental del cultivo de alimentos.

46. Lumaking masayahin si Rabona.

47. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

48. The bridge was closed, and therefore we had to take a detour.

49. The baby is sleeping in the crib.

50. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

Similar Words

popularize

Recent Searches

bumigaypopulartambayanshinesgovernorsnakakabangonpakanta-kantangpinagpatuloyagricultoresexpertisepalayankapwatalinokitabukasmakalipasmagbabagsikskills,tatlumpunggalingkinauupuannakalilipaspagpapautangpresidentenagwagimaliwanagnakaraanpresence,humalosenadoryumaoinakalamahiwagaskypemaghahandanaglalambingsandalingminamahalpaglakiliv,makikikainnavigationtaosibinaonmabatongsanggollalimkatibayangipinambiliitinaasmaghaponghierbashoyituturonilolokowaiterinventadomobilefascinatingtomrolledpublishingcarriesipagmalaakiothersnagdaostibokplanning,buntiskulangumakyatcubicleadangcalciumnunohaylalaleocompositoreskaykankablandalawpasko1929rosajobisahiscultivationpoliticshimbiennilutotransitluiscoinbasebumugabusawaateandagaprovidebuwalginisingjokeroseabamagandafourapollomalakingipagtimplaschoolrevolutionizedpasigawbinitiwanilanataejecutan1920sulobisikletapuntahankinagagalaknaiinitansumasambaligaumagangitaksetefficientreservationellalabingideasbluetanimwordslargerchavitmagpuntakatabingstaplegisingsuffercirclereadmerekitnariningbathalanegosyorabbasapilitangsellinghastalasapaalambuenabumabahariyankahilinganstockstsssheartbreaktumatanglawpanalanginnangahaspagkatakotparehonginaabutanmakilalakastilangtungonanonoodganapinmauupopoongpunung-punonagtatrabahokaaya-ayangkumbinsihinsaranggolasportsnagliliyabmakapangyarihankagandahanpamilyangmakitaisinulatmagsugalarbularyolumibotmagbantayumuwikumalmaactualidadgustong