Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

2. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

3. Holy Week markerer også starten på foråret og den nye vækst efter vinteren.

4. The stockbroker warned his client about investing in risky assets.

5. Sa bawat tagumpay, dapat tayong magpasalamat at magbigay ng pagkilala sa mga taong tumulong sa atin, samakatuwid.

6. Humahaba rin ang kaniyang buhok.

7. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

8. Sa ganang iyo, sapat ba ang paghingi niya ng tawad upang mapatawad ng lahat?

9. Kailangan ko umakyat sa room ko.

10. May biyahe ba sa Boracay ngayon?

11. Kapag hindi tama ang timpla ng pulotgata, maaaring maging mapakla o mapait ito.

12. Kailangan mo rin ng malalim at malusog na lupa na may sapat na konsentrasyon ng nutrients

13. Sa aming bakuran, nagtatanim kami ng mga tanim na pampalasa tulad ng luya at sibuyas.

14. May mga salarin na gumagamit ng iba't ibang modus operandi upang mabiktima ang mga tao.

15. Les employeurs recherchent des travailleurs fiables et ponctuels.

16. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

17. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

18. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

19. Magdidisko kami sa makalawa ng gabi.

20. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

21. Ano ang pangalan ng doktor mo?

22. They admired the beautiful sunset from the beach.

23. Hindi ko matitiis ang mga taong maarte sa mga pagkain na hindi naman talaga kailangan.

24. Dapat natin itong ipagtanggol.

25. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

26. Hindi niya naiilagan ang dagok ni Ogor.

27. Las vacaciones son una oportunidad perfecta para desconectar del trabajo.

28. Ordnung ist das halbe Leben.

29. Emphasis can be used to persuade and influence others.

30. Eksporterer Danmark mere end det importerer?

31. Sa mga himig ng kundiman, nadarama ang tibok ng puso at pagkakaisa ng mga Pilipino.

32. Maaaring magbago ang pulitika ng isang bansa dahil sa digmaan.

33. Hinde pa naman huli ang lahat diba?

34. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

35. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

36. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

37. Espero que te recuperes pronto, cuídate mucho y sigue las indicaciones del médico.

38. Sa wakas, aalis na si Ogor, naisip niya.

39. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

40. Isang araw nagkasakit si Aling Rosa.

41. Botong boto nga sayo ang mga magulang ko eh.

42. Sa mga lugar na mabundok, naglipana ang mga halaman na katangi-tangi sa kanilang ganda.

43. El uso de drogas es un problema grave en muchas sociedades.

44. At nakuha ko kaagad ang attention nya...

45. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

46. Nasaan ang Katedral ng Maynila?

47. Magandang umaga Mrs. Cruz

48. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

49. Tahimik ang kanilang nayon.

50. Pada umumnya, keluarga dan kerabat dekat akan berkumpul untuk merayakan kelahiran bayi.

Similar Words

popularize

Recent Searches

popularglobalgulosumalakaypinatidmeronkalabandamdaminmatagal-tagalbulongtag-ulanibafauxhongestarusedcurrentlumulusobsumindimatatagpwedebatitugonmanamis-namiskabangisanhomenegosyobusinessespumansinspongebobmalapitnatatanawpalabaspambatangmanoodminabutiwhichwalngtayounitedtobaccokahittangingtag-arawstudiedstorystorestatesourcesongsignreviewersaccederpuedespresidentbayangnasasakupanhalu-halomulighedpowerpointplayedpicturepaulpanghimagaspanghihiyangpagitannakaramdamnag-asaranmalambotmagsi-skiingmagbayadkinatatalungkuangincidencedahilinalagaangrewgiveriwangermanyasoflamencoeventosenforcingdependcarmenbridearmedadventaddingnapasubsobvibrateamuyinnagagamitginagawapangungutyanawalanagkapilatbatangnaiwangintokagandaagilityritoakmaalledsanagbasasarilitandatuyogagawabalitapagdiriwanglalawiganpinilitwaittrackdettesandokmahahalikdingginmaitimhumahangasinaumigibnakapapasonghanapbuhaynitongsubalitmulingwashingtonperadatupostertahananmagamotgoodanitokuwentopaligidsapotganyannapakapinakamatabanganakpagkaawamartagitnanaawayoungburdenpagsusulitnaalisibigmahinagayunmanpabilimisalibingpupuntahanulamkinakarununganirognapakagandangstonehamreplacedsayumiibigkayahalakikilospamahalaanpamilyatarangkahan,paskoselebrasyonleaderstalentkantonakangitiisinaraabanganmangyarimerlindakawalanmahalinespadaamparokinakitaanbiyasbrasopanamaalas-tressimprovementtrajefertilizerspindledemocraticnanaig