Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ella yung nakalagay na caller ID.

2. The birds are not singing this morning.

3. Kumakain ng tanghalian sa restawran

4. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

5. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

6. Kahit na magkaiba kami ng wika, naging magkaibigan pa rin kami dahil sa aming kaulayaw sa isa't isa.

7. Mas mainit sa Pilipinas kaysa dito.

8. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

9. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

10. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

11. Naalala niya ang itinuturo ng misyunero na si Hesus daw ay muling nabuhay pagkalipas ng tatlong araw

12. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

13. Gusto ko sanang makabili ng bahay.

14. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

15. La santé est un état de bien-être physique, mental et social complet.

16. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

17. Hindi ka sanay sa matinding init? Kung gayon, manatili ka sa lilim o sa malamig na lugar.

18. Television has a rich history, and its impact on society is far-reaching and complex

19. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

20. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

21. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

22. The company's growth strategy is focused on acquiring more assets.

23. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

24. Sa Pilipinas, ang tag-ulan ay kadalasang nagsisimula mula Hunyo hanggang Nobyembre.

25. Acts of kindness, no matter how small, contribute to a more charitable world.

26. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

27. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

28. The officer issued a traffic ticket for speeding.

29. Ang poot ang nagpapagana sa aking determinasyon na magtagumpay at patunayan ang aking sarili.

30. Einstein's legacy continues to inspire and influence scientific research today.

31. I am not watching TV at the moment.

32. Lumampas ka sa dalawang stoplight.

33. Durante las vacaciones, a menudo visitamos a parientes que viven lejos.

34. Sama-sama. - You're welcome.

35. Ayaw ng nanay kong magtrabaho sa Linggo.

36. Natayo ang bahay noong 1980.

37. Kayo din po ba ang nagpapakain sa kanya?

38. Nagbuntong hininga sya, Akala ko naman.

39. Sa pamamagitan ng bayanihan, nagkaroon kami ng pag-aayos ng mga kalsada sa aming lugar.

40. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

41. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

42. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

43. Hindi naman yan iniisip eh! Pinapakiramdaman!

44. Sadyang kaunti lamang ang alam kong mga lenggwahe.

45. Hindi maganda na maging sobrang negatibo sa buhay dahil sa agam-agam.

46. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

47. Kailangan ko ng lumisan mahal ko.

48. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

49. Don't put all your eggs in one basket

50. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

Similar Words

popularize

Recent Searches

dumaanpopulardisyembrebilibnuhsusulitpaksamaibalikeducationlumilingon1950sgiveredsacharismaticshinesninongpangalankulaydissepasensyajocelynkarapatannaiinitanaksidentefarmthankiskedyulsoundyunbateryamatarayfitmalikotinanglimitedkabuhayankarangalancnicolilyayawbahaysumingitsusikatagalanambagsinetinikiniintaybinanggaangaltinitindawifinatagalankamustanagisingwikaculpritdeterminasyonaddictionvehiclestinderaahasblazingfonoscapitalisinalangamojoealexanderreachkapeharapbusog1920ssipaonlineskypedemocracynakapuntabalancesgraphicsuotparosamakatwidmustparikalakingnunocasasinimulanasthmadangerousbotantelalapalaytiniocassandraaniyakikomaulitfauxbestcomputere,operahanlarodyipleadingaumentarpriestsawaadoptedpabalangbumabahamembersinterestsbusyzooareashmmmbingbinghomeschoitshirtbigyanmalakialamidfriendsbuenahopelandfilmsmedyomagisingtupelokamatiskabibiconnectingboboscientificisugamulighedplacebaling1980kerbterminodalawpitongasulbernardostillmalapadnyasabihinglordclaseshangaringcompostelabisigorugamabilistoothbrushspentleopeepbrindarminutoreadersjoshaywanallottedbecomebinawimadamikadaratingestarsinapakdiamondinantokkablanmestbecomingpiecesremainbusiness,clientsiniwansyaayonlamansparenumerosasadversemoderneamparoduonsalahojasorderinmahahaba