Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Hindi ako nakatulog sa eroplano.

2. Les patients peuvent avoir besoin de soins psychologiques pendant leur hospitalisation.

3. The students are studying for their exams.

4. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

5. The information might be outdated, so take it with a grain of salt and check for more recent sources.

6. Napatungo ako dahil nangingilid na naman ang mata ko.

7. Magsi-skiing ako sa buwan ng Enero.

8. Nakangisi at nanunukso na naman.

9. Na ikaw ay isang musmos lang na wala pang alam.

10. He cooks dinner for his family.

11. Protecting the environment requires a collective effort from individuals, organizations, and governments.

12. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

13. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

14. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

15. Nakarating na si Ana sa gubat at pumasok sa isang kweba at lumabas ng may dalang basket na puno ng ibat-ibang uri ng gulay.

16. Tumahimik na muli sa bayan ng Tungaw.

17. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

18. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

19. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

20. At følge sine drømme kan føre til stor tilfredsstillelse og opfyldelse.

21. Kailangan nating magtiyaga at magsumikap sa ating mga pangarap, datapapwat ay hindi ito agad-agad natutupad.

22. She loved to travel, and therefore spent most of her savings on trips.

23. Marurusing ngunit mapuputi.

24. He is having a conversation with his friend.

25. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

26. Pakibigay ng pagkakataon ang lahat na makapagsalita sa pulong.

27. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

28. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

29. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

30. La santé est un état de bien-être physique, mental et social complet.

31. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

32. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

33. Napakabilis talaga ng panahon.

34. Pinaayos ng paaralan ang ilaw sa silid-aralan upang hindi na magkakaroon ng problema sa lighting.

35. Hindi niya tinapos ang kanyang proyekto sa tamang oras, samakatuwid, hindi siya nakasali sa kompetisyon.

36. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

37. Pupunta ako sa Iloilo sa tag-araw.

38. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

39. Sa gitna ng pagdiriwang, naroon pa rin ang kanyang hinagpis na pilit niyang itinatago.

40.

41. Shaquille O'Neal was a dominant center known for his size and strength.

42. Inakalang wala nang pag-asa, pero may dumating na tulong.

43. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

44. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

45. Kumain siya at umalis sa bahay.

46. Me gusta preparar infusiones de hierbas para relajarme.

47. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

48. Napahinga ako ng malakas kaya napatingin siya sa akin

49. Paano ka nakapasok sa bahay kagabi?

50. Tesla is an American electric vehicle and clean energy company.

Similar Words

popularize

Recent Searches

popularbibilhintaga-nayoncelebrasamakatwidnagsibilikayaparenagagamitpunung-kahoylever,espanyangbosslorysisipainpangbangnapipilitannakauwinapadungawcauseshamakaalisnakikisaloumuusignasunogsirabansangsinunodnapabalitanagbalikmatutulogalignskabutihannakakaalamlilikoprimerasibinalitangbinigyangditoadditionallypapuntaidolsupilincakeandrewanjomakapalagkakaibangmaalikabokpagiisipmailapalwaysendvideremidtermiginawadkaano-anowhateverngunitmabuhaywhatsappkakainindogspuwedeunakaarawanpagkakatayonagpadalanagpasyahargovernmentsukatjingjingcommunityalitaptappinagtagpobutiyumabonglibangannapupuntaincreasemalayangisadahan-dahanvisualauthorginoofiabingoshoesfurtherfacilitatingcultivarhabangduliisasagotbinawikasawiang-paladkaninveststoreksportererrebokaminaglalakadhapag-kainanlokohingamitpag-asamagazineskartonmarurusingpunoeachreplacednewsbudokjosefalalakinglunetakahonkarapatanpamburamagkasakitmagtatagalinitmasasalubongkasamaakoparagraphsourbeginningsbalikhigh-definitionmostnakatitiyakmusicsinalansantatagalnoonbulongbalitameronkendiiniinombunutanpaginuulammatiwasaymikaelapakealamasawapayongkumakapitpneumoniainiibigeuropemag-ingatnakakunot-noongmagdalamaihaharapkatagasinehanlawspagtitindamadalasmagpuntatawadkahitpanamadeathdaramdaminsoonaksidenteestámaka-yonakaimbakhalosyourself,proveintosandaliyou,magasawangtingnankapemapaibabawnawalahagdanmabangodyipnilasingkahalagadatireguleringnabuotrendraft:nagpasantsismosa