Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sadyang nagulat ako sa kanyang biglaang pagbisita.

2. Disfruto explorar nuevas culturas durante mis vacaciones.

3. Kumain ako sa kapeterya kaninang tanghali.

4. Acts of kindness, no matter how small, contribute to a more charitable world.

5. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

6. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

7. Binisita ako ng aking kaibigan na matagal ko nang hindi nakita kaya masayang-masaya ako ngayon.

8. Humingi ng tulong ang magsasaka sa albularyo dahil naniniwala siyang may kulam sa kanyang hayop.

9. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

10. Les soins de santé de qualité sont un droit fondamental de chaque individu.

11. Dahil sa kanyang masamang ugali, siya ay isinumpa ng mangkukulam.

12. Sana ay makapasa ako sa board exam.

13. Einstein's writings on politics and social justice have also had a lasting impact on many people.

14. Bukas ay pumunta daw po kayo sa school sabi ng aking teacher.

15. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

16. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

17. Hun er min store forelskelse. (She's my big crush.)

18. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

19. He admires the athleticism of professional athletes.

20. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

21. Kahit hindi ako nagpapakita ng kilos, crush kita pa rin sa loob ng puso ko.

22. Work can also have a social aspect, providing opportunities to meet new people and make connections.

23. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

24. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

25. Hindi ko kayang hindi sabihin sa iyo, sana pwede ba kitang mahalin?

26. Ikaw ang iniisip ko bawat oras ng buhay ko.

27. Kailan nangyari ang aksidente?

28. Aalis na ko mamaya papuntang korea.

29. Nais ko sanang sabihin sa iyo na may gusto ako sa iyo nang mas maaga pa.

30. Ang Ibong Adarna ay nakapagbigay ng inspirasyon sa maraming manunulat at makata upang magsulat ng kanilang sariling mga obra.

31. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

32. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

33. Sinuman sa kaharian ay walang makapagbigay ng lunas.

34. Arbejdsgivere søger pålidelige og punktlige medarbejdere.

35. Sa pagpapakumbaba, maraming kaalaman ang natututunan.

36. Napaangat ako ng tingin sa kanya saka tumango.

37. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

38. Tweets are limited to 280 characters, promoting concise and direct communication.

39. Børns sundhed og trivsel bør være en prioritet i samfundet.

40. Magkapareho ang kulay ng mga damit.

41. Nakapag-simula ako ng halinghing exercise nang hindi inaasahan na makakatulong ito sa aking anxiety.

42. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

43. Bawal magpakalat ng mga pornograpikong materyal dahil ito ay labag sa batas.

44. La tos puede ser tratada con medicamentos, como jarabes para la tos y expectorantes.

45. Botong boto sa kanya ang mga magulang ng kanyang kasintahan.

46. Dala ng hinagpis, nagdesisyon si Mario na magpakalayo-layo upang muling hanapin ang sarili.

47. Nació en Caprese, Italia, en 1475.

48. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

49. May meeting ako sa opisina kahapon.

50. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

Similar Words

popularize

Recent Searches

bitiwanlandeconsumepopulardisyembrehappenedshineskinantabritishedsanaglipanaburdennagreplyloridolyarglobalpaytomarsusunduinroonwowtrafficso-calledwaliscrosscriticsbasahanbienmisamesangbroughtritwalandoybagamatamadnaghuhumindigmarieshoppingsandalingtengatibokmamarildadalonilapitanannikanagdaospagpasokbayangnovembermaglabamauntoginstitucionessalamatmedya-agwahinawakancornersumakyatsumisidnakinigtsssartemasipagtusindvisdesarrollarnararapattonetteforståmangingibigwinstugonwednesdayapologeticwaiterkombinationsalbahenasanmatipunoisamahinabolincidencecolorhomeworkchickenpoxlikeadvancedsiglosumangmalapitpublishing,charminginalagaanplagasemailbumugaisaakocoachingjeromeincludingmentalginisingespadalulusogpasandontdesigningyansakalingtemparaturahitanaiinggitferreremphasisagekapangyarihanfatalgrabeibabacontinueskartonpopularizeislachambersheipresssalapibarhardkingneaposterdinigenerationerconstitutionfeedbackimpitpotentialforcesactioncrazyupworkinilingitinuringmiyerkulesbehalfinspiredcashdoonbabamobilebeingbringcalldinalaobstaclespagpapakainnag-aalanganngingisi-ngisingipinakitamaskikaninamatatagugalinaawaipapaputolalas-tresnapapikitkinabubuhaypupuntahanubos-lakaskondisyonhandesign,nabitawandatungnextpapalapithabangschoolnagpasyamournednakakatabapaghingitsinanangangaralaayusinmensahepangalanpagongmgaitutuksomaaloganilamaranasansubject,kindlenagbagomaghintaymaistorbohalingling