Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. The foundation's charitable efforts have improved the lives of many underprivileged children.

2. Hindi ko maintindihan kung bakit kailangan pang magpaplastikan kung maaari naman nating sabihin ang totoo.

3. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

4. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

5. Nasanay na siyang salatin ang dingding para maghanap ng switch ng ilaw.

6. Il est important de connaître ses limites et de chercher de l'aide si l'on rencontre des problèmes liés au jeu.

7. The acquired assets included a portfolio of real estate properties.

8. Tolong jangan lakukan itu. - Please don't do that.

9. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

10. Hay una gran cantidad de recursos educativos disponibles en línea.

11.

12. Doa dapat dilakukan oleh siapa saja, tanpa memandang agama atau keyakinan.

13. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

14. Pare-pareho talaga kayo mga babaero!

15. Hindi naman siya masyadong maarte pero ayaw niya ng mga gusot sa kanyang mga damit.

16. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

17. Las escuelas también ofrecen programas de educación para adultos.

18. Nagsasagawa ako ng mga pagsisikap upang maging maganda ang impression ng aking nililigawan sa akin.

19. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

20. She has lost 10 pounds.

21. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

22. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

23. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

24. The pretty lady walking down the street caught my attention.

25. Taon-taon ako pumupunta sa Pilipinas.

26. Maaliwalas ang simoy ng hangin sa probinsya.

27. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

28. Nagbigay ng kanyang opinyon ang eksperto ukol kay President Bongbong Marcos

29. Kunwa pa'y binangga mo ko, ano, ha? Magaling, magaling ang sistema ninyong iyan.

30. Nationalism has been used to mobilize people in times of war and crisis.

31. Masakit mang tanggapin, sa pamilya pa rin ang tatak ng iyong pagkatao.

32. Taga-Ochando, New Washington ako.

33. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

34. Madali ka nitong bibigyan ng paninda kung may sarili kang bangkang paghahanguan ng mga huling isda sa karagatan.

35. Mahal ko ang pusa ko dahil malambing siya.

36. From its early days as a technology for the elite, to its current status as a staple in most

37. Mahusay mag drawing si John.

38. Los héroes son personas valientes y audaces que se destacan por su coraje y determinación.

39. Los fertilizantes orgánicos son utilizados en el cultivo ecológico para enriquecer el suelo.

40. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

41. She is not playing with her pet dog at the moment.

42. Nakapagsasakay ang dyipni ng 16 na pasahero.

43. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

44. Kasingtigas ng loob ni Sultan Barabas.

45. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

46. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

47. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

48. I'm sorry, I didn't see your name tag. May I know your name?

49. Magdamagan ang trabaho nila sa call center.

50. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

Similar Words

popularize

Recent Searches

siemprealampopularnagtatakarabbanapawifrogmalabosumakaypootpagkahapoinventionnauntogpagkaimpaktolipadgowndevicescalciumritobroadbulalasrelativelysumalituktokmalapad2001upuanhinahaplosikinatatakotjuliusnaibibigaynahigitanjingjingyumabangnapatakbomaranasandilawpakibigayokaydalagangmasasayababestinahaktrademaliksibirdsnagtalagaipatuloykalakihanipanlinisgagambanagtatampouniversitiesngingisi-ngisingnanahimiknagpaiyaksinenagtakataos1954pagpapakalatnapatulalatoyfulfillingnananalonganayiniinomkinalimutanpapalapitnowideainiibigaidskypemultolegendagilitywordreservedlalakengtumalabtungobinawiankaarawanumangatsteerimpactedyontiningnanpalayanberetitanyagmahiwagarepresentedmagisipiniisipprogramagitnapangulosequesutilclassmatelumayolearntakotreturnedinterpretingbasaprimernababalotnakaliliyongmarielmakilalagraduallyhigh-definitionnuevosperseverance,barung-barongmagawanagngangalangpumupurinatitiramagbibiladbulaknapatayoseriouspakibigyandemocracykasuutaniiklihinukayweremarangyangpatutunguhanistasyonnakagawian1980sikre,gumagalaw-galawnapapalibutanincrediblemasiyadomasilipinvestbaldengmahabamagsimulamesaeksport,haringpinangalananganywherehitsurainaaminogsåsportsnamatayiwanankumidlatika-12tayonagtutulunganimpormahinangmaliwanagnalalabingchecksnagtrabahopinatiraattorneymusicalesnakaangatnakakitatwinkleupontransportforskelnagkalapitpakistandumaramikontingpanaydonbilhinaltbuntislalakadcontent,mangkukulammaghatinggabimangingisdakaibangumaasananghingiligayapangitnakasakitlivesfridaytsinelas