Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Nagkatinginan ang mag-ama.

2. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

3. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

4. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

5. Kailangan kong hiramin ang iyong pliers para sa aking proyektong DIY.

6. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

7. Isa kang hampaslupa! saad ng matapobreng babae.

8. Dahil sa patuloy na pagtitiyak sa kalidad ng mga produkto at serbisyo, yumabong ang negosyo ng isang kumpanya.

9. Anong oras nagbabasa si Katie?

10. Scissors have handles that provide grip and control while cutting.

11. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

12. Sa ganang iyo, may pag-asa pa bang magbago ang taong matagal nang naligaw ng landas?

13. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

14. Gaano ho ba kalaking lupa ang gusto ninyo?

15. Nakatingin siya sa labas ng bintana, waring may hinihintay.

16. The acquired assets included several patents and trademarks.

17. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

18. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

19. They are not running a marathon this month.

20. Ano ang nasa tapat ng ospital?

21. Kapag may mga hindi malinaw na balita tungkol sa kalagayan ng kalusugan, maaaring magdulot ito ng agam-agam sa mga tao.

22. Ano ang ipinabalik mo sa waiter?

23. "Mahirap magtiis, pero mas mahirap ang walang tiis" ay isang bukambibig na nagpapahiwatig ng halaga ng pagtitiis sa mga pagsubok at paghihirap sa buhay.

24. A veces, la paciencia es la mejor respuesta ante una situación difícil.

25. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

26. Tila hindi pa siya handang harapin ang katotohanan.

27. Makapiling ka makasama ka.

28. Ang ilong nya ay matangos naman ngunit bukaka ang mga butas.

29. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

30. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

31. Nagtayo kami ng aming tindahan, bagkus hindi pa ito gaanong kilala ng mga tao sa lugar namin.

32. Ang sugal ay isang aktibidad na nasa ilalim ng panganib ng pagkakaroon ng adiksyon at mental na kalusugan.

33. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

34. Ang aming koponan ay pinagsisikapan na makuha ang kampeonato sa darating na liga.

35. Palaging nagtatampo si Arthur.

36. Dahil sa sobrang ganda ng lugar, nahuhumaling ako sa pagba-vacation sa ibang bansa.

37. Danmark eksporterer også en betydelig mængde medicinske produkter.

38. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

39. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

40. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

41. Cut to the chase

42. Ano ang pinapanood mo sa telebisyon?

43. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

44. Ano ang malapit sa eskuwelahan?

45. Magbantay tayo sa bawat sulok ng ating bayan.

46. Layunin ng Espanyang sakupin ang mga katutubo.

47. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

48. Ang pagbabayad ng utang ay magpapakita ng pagiging responsable sa pagpapalago ng financial status.

49. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

50. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

Similar Words

popularize

Recent Searches

popularnahihirapankanilangtimedi-kawasatemperaturaboksinglandnakuhangbiologipalancateamgaanomaranasanmayabangmag-alasewanyoutubepinangalananpagtataposkagubatanbecomingbossinissukatmatagpuaniguhitnewsmamasyalpogipalaisipaniwinasiwasheipadabognagbibiromahiyaaniyapagsahodipaliwanagmarsogownisinakripisyonecesario4thpinakidalabosespinyainventionquarantinebasketbolngingisi-ngisingpancitpakealammaistorbonagpasansilaypumayagpayongenchantednanghahapdinothingmahuhulicitizenmagnakawreboundnegativetabingwordmasakitxviibandaalas-dosconectadosparanapagtantonapalakascallingbeginningsallowedlakadmakaratingtumubolabananexitmenugitanasmanonoodafternoonpermitekotsebansatripkaswapanganmumuntingpookdealbintanamayabongtumulakmarilousasayawinkesokulaynapilitanmalapitdalhanjamesbabesmonitordiningbanlagdadalawinkatuwaanitakumiisodmangahasnewspaperspinagtagposponsorships,birthdaybecomearghentertainmentikinagagalaknagkitanakatulongcalidadpaghihingalobusynapatigilnakaincornersmaipapautangkanserinterestburgerhumihingalumaagoskamotesaranggolabisigapatnapupulongwalismobiletiniklingpesosfurycross1954irogmagsusunuranculpritmagpagalingbroadcastaywanmagdapowerpanalanginkriskanapapatungoumakyatkangkongkagayamakakakainpropesorwindowrelevantmagkakaroonmananakawlegacyninanaisimprovedmemomakikitulograwkinakailangannoodwellnapadpaditinagonaalaalanaglipananginteligentespinakabatangsourcemayamansagingpaggawatalagapaglayasaskshapingpambansangkaninonakaupopinagmamalakinoblemagpa-ospitalbumubula