Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

2. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

3. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

4. Nagkakamali tayo sapagkat tayo ay tao lamang.

5. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

6. Tiyak na may isda kang mahuhuli! Sige, layas! Layas! pinagtulakan ni Kablan ang kaawa-awang matanda na napasubsob sa tarangkahan ng malaking bahay.

7. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

8. Sa naglalatang na poot.

9. Isa sa nasa pagamutan na iyon si Bok

10. It is important to have clear goals and expectations in the workplace.

11. The chef is cooking in the restaurant kitchen.

12. The team's performance was absolutely outstanding.

13. Emphasis can be used to create a sense of drama or suspense.

14. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

15. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

16. Nasa Massachusetts ang Stoneham.

17. Amazon's customer service is known for being responsive and helpful.

18. Cryptocurrency can be used for both legal and illegal transactions.

19. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

20. Napilitan siyang bumangon at naghanda ng pagkain.

21. Scientific evidence has revealed the harmful effects of smoking on health.

22. Biasanya, bayi yang baru lahir akan diperiksa secara rutin oleh dokter atau bidan untuk memastikan kesehatannya.

23. In some cuisines, omelettes are served as a light lunch or dinner with a side salad.

24. She draws pictures in her notebook.

25. Wer den Schaden hat, braucht für den Spott nicht zu sorgen.

26. Alles Gute! - All the best!

27. Tantangan hidup adalah kesempatan untuk belajar, tumbuh, dan mengembangkan ketahanan diri.

28. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

29. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

30. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

31. Nagitla ako nang biglang umalingawngaw ang malalakas na putok ng paputok.

32. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

33. Hindi mo na kailangan humanap ng iba.

34. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

35. I have seen that movie before.

36. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

37. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

38. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

39. Microscopes have played a critical role in the development of modern medicine and scientific research.

40. Tila malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

41. El discurso del político está llamando la atención de los votantes.

42. Wives can be loving, supportive, and caring companions to their spouses.

43. Ilan ang mga puno sa bakuran ninyo?

44. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

45. Der er mange forskellige typer af helte.

46. Scissors can be stored in a scissor case or stand to keep them organized and easily accessible.

47. Ang ganda pala sa enchanted kingdom!

48. Kanino mo pinaluto ang adobo?

49. Naging mas makapal nga ang buhok ni Rabona.

50. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

Similar Words

popularize

Recent Searches

ibinalitangpopularrevolutionizedhumalakhaknagbungasumusunoproperlysystematiskdollybitiwanearnexamumingitexcusebalingcenterclientscompostelasubalitgetnasunogmarkedparatingbangoslungkotideaconnectionadditionallydaigdigincreasinglynaroonhardiosbigkasinggandaencounterspamabutingsumalayoungstonehammamicongratsteachtomarroboticintroduceouecafeteriatanimtools,pagedyansettingincreaseshighestreturnedseparationmitigatebroadcastingpersistent,sambitinvolveinfluencebathalamagbubungaevensteernasa1970ssasamapagtangisokayipinagbilingeksaytedkaninateleponothreenamulattinungocourtmakipagtagisanmaibiganproducererplantasenergiunconstitutionalsagaptoykantobinatangnagingsalapinag-aaralanpaparamipalagaymahiligmagpapaligoyligoyresumengustonganumancouldmagkakapatidbecomingpinapaloiyakperatumatawagdaangkumukuhanakasuotbagkusworldwithoutpopcornmagsinusuklalyantsonggokamag-anakipinadalapictureviewssarongtuktokngapulubimiyerkulesaddictionmaestrocontentmukhahugis-ulopabalangalas-diyescultivatedkaysavisualmang-aawitnaghubadnagsasagotkagabipaki-translatenagtatanongpondogupitlineinlovewebsitepaghuhugasprotestamakapagempakebowlbalangnasiraadversekomunidadnagpatuloylimitaabotcryptocurrencyninakalalakihankinalakihankidkirankatutubokondisyonculturasnagbibironakabluekayabanganpagtatanimbitawanmahiyainvestnagtalagapumitastatayopakakatandaankinasisindakanmaghahatidkubyertosautomatisknalalabinasasakupanpinagsikapannagliliwanagnaglipanangmakalaglag-pantysinasadyamatalinonagpuyospinagkiskismakapalagmakasilongmagkaibangnaabutannagsunuranitsuraeksempelhimig