Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Masasaya ang mga tao.

2. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

3. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

4. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

5. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

6. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

7. Hindi naman yan iniisip eh! Pinapakiramdaman!

8. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

9. They are hiking in the mountains.

10. Gusto ng mga batang maglaro sa parke.

11. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

12. Pagpasok niya sa bahay, nabigla siya sa liwanag na biglang sumulpot.

13. Nanggaling ako sa isang malakas na liwanag papunta sa pagdidilim ng gabi, kaya't nahirapan akong mag-adjust sa aking paningin.

14. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

15. He was born on December 30, 1984, in Akron, Ohio.

16. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

17. May anim na silya ang hapag-kainan namin.

18. Nasa labas ng bag ang telepono.

19. Si Emilio Aguinaldo ang unang pangulo ng Republika ng Pilipinas.

20. Beast... sabi ko sa paos na boses.

21. Nasaan ang Katedral ng Maynila?

22. La calidad del suelo es un factor clave para el éxito de los agricultores.

23. Mathematics is a language used to describe and solve complex problems.

24. Ano ang ginawa mo noong Sabado?

25. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

26. Uh huh? medyo naguguluhan kong sabi.

27. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

28. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

29. She admired the way her grandmother handled difficult situations with grace.

30. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

31. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

32. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

33. Hendes skønhed er betagende. (Her beauty is mesmerizing.)

34. La realidad es que todos cometemos errores, pero debemos aprender de ellos.

35. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

36. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

37. Kailan niyo naman balak magpakasal?

38. Nag toothbrush na ako kanina.

39. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

40. Halos de-lata na lang ang lagi nitong inuulam.

41. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

42. Baka roon matutong matakot iyan at magsabi ng totoo.

43. Pinagpatuloy ko na ang pagkain ko.

44. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

45. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

46. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

47. Nagluto ako ng paborito kong pagkain kaya masayang-masaya ako ngayon.

48. ¡Hola! ¿Cómo estás?

49. It is a versatile dish that can be customized with various fillings and toppings.

50. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

Similar Words

popularize

Recent Searches

popularprusisyonbulsasisidlantabioffentligedoble-karapasaheromiyerkulescarbonnanunuksomorefredsaradopinyasandokgamottubiginaapimagtatanimtibokkanya-kanyangkanyaaddbabymakahinginagpabotfacenagitlastillnakakagalingilihimpagtitindanovemberbilangguansunuginnagtatanimkaalamanpangarapcrossmananalokongresoagadaramdaminkalamansitumakbobluessiniyasatgenerositymagselosna-fundkinakailangansalamatiginawadposternaiinitankagabisabongecijamalilimutinstarkamandagrawsinunggabannakikilalangdyankaurilalakisumamaangyeheykundibinigyanpagtinutoppinag-aralangownikinamataybinatoworrymakapag-uwiulapmanamis-namisapollotungkodmag-ingatkanangrestaurantnewspinangaralanmatagumpayhalamankakatapospanggatonglegitimate,serblusangothers,sana-alljosienasaangeologi,proyektomonumentopaninigaskailanmaniniligtashinawakansikmurakeepingnamangtumingalavedvarendefulfillingparurusahanipinansasahogtrapiknagdiskomatutongsiksikancommunicationeksempelbornboksingkasamapagtinginbalancesleegespadaplanmagbibiyahepedromagpakaramipakakasalanmagkitamagigingadditionallyjuanmalamanpatakbongbroughtpalagimodernregaloma-buhaydaigdigpagkaganda-gandastreetipongginugunitatamasesamesaan-saandecisionsbelievedintroducenagngangalangpagtiisanmakapalagclientesflightbuwayadrayberkaynagwagiaddresssangkalanpagpanawmarasiganisasabadmgayourself,tawanannakayukoipinatawsusunduinnabubuhayfeedback,palayanmagawaearningnakakaliiggrupotiniklingmasasabistartedagadthroughvocalsumalakaypanaypag-aapuhaprepublicannapakabaitiligtasngayobinatilyopagongmatagal