Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa dakong huli, na-realize ko na mahalaga ang aking mga kaibigan.

2. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

3. Gusto mo bang sumama.

4. Sinabi niya sa dakong huli na gusto na niyang mag-resign sa trabaho niya.

5. Hindi ko kayang gawin yun sa bestfriend ko.

6. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

7. Nagbabakasyon ako tuwing Abril.

8. Sino ang kasamang kumanta ni Katie?

9. Paglalayag sa malawak na dagat,

10. Lord, Wag mo muna siyang kunin..

11. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

12. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

13. Nangangaral na naman.

14. Libre ba si Renato sa Huwebes ng gabi?

15. He was busy with work and therefore couldn't join us for dinner.

16. El que busca, encuentra.

17. Isang araw sa kainitan ng tanghali, isang mahiwagang babae ang dumating at kumatok sa mga pintuan ng mga taong bayan.

18. She admires the bravery of activists who fight for social justice.

19. Payapang magpapaikot at iikot.

20. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

21. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

22. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

23. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

24. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

25. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

26. They are not cleaning their house this week.

27. Después de la clase, los estudiantes salen del salón y van a casa.

28. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

29. I love you, Athena. Sweet dreams.

30. Nag-aaral siya sa library gabi-gabi.

31. Ang magulang na mabuti, ang anak na sumusunod.

32. Después del nacimiento, el bebé será evaluado para asegurarse de que está sano y para determinar su peso y tamaño.

33. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

34. Las plantas suculentas son conocidas por su capacidad para almacenar agua en sus tejidos.

35. Nogle helte er kendte for deres modige handlinger under krig.

36. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

39. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

40. Gaano karami ang dala mong mangga?

41. Teka bakit dinala mo ako dito sa labas?!

42. Maingat niyang sinalansan ang mga tuyong kahoy sa ilalim ng kanilang bahay upang huwag magising ang kaniyang mga magulang.

43. Wala kang kuto noh? nabigla ako ng magsalita sya.

44. The detectives were investigating the crime scene to identify the culprit.

45. Alas-tres kinse na ng hapon.

46. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

47. Mayroon umano siyang lihim na kayamanan na itinago sa loob ng maraming taon.

48. Paano ho pumunta sa Manila Hotel?

49. The United States is a federal republic, meaning that power is divided between the national government and the individual states

50. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

Similar Words

popularize

Recent Searches

homethankpsssaksidenteutilizarkinantapopularstreetkinisscanadanumerosaskabosessumayalosslinggosipangumingisisnaparangnunotiketbiglademocracymayabangpadabogosakalutopopcornipinadalapierconsistreboundgearrosakunwatalagawaldosiyagisingcollectionsclasestuwangbangmanuscriptasullungkotayudatonipagbilibasahanimportantesmedievalnahulireloaniitinaliginisingconsideredinaliswealthalamroserolledtalestylesbadsummitgraduallyinteriorskillandresprogrammingpaceviewbilingcallingactormenuhumalomagwawalawatawatnag-aaralhinipan-hipannakakasamatinulungansinumancureddaramdaminkababalaghanggiyeranapapag-usapanmahigpittenidobagsak1954tigassweetdreamnalalabibirthdayparkingbisigtelangprutasdaantendercomplicatedluisbowewangiitcubapinagkiskispusonapalitangnaglokohanchoosekutolearningawitanimportantothers,patientrightsnakapikitmartianamendmentsmataraypagkaawapansamantalapanahonlegislationnagbunganasiralumagoitinuringiospamahalaansapatosmasaktantahanansolculpritmanamis-namismakapangyarihangmakakasahodsalamangkerolalabhanpagbigyankumikinigturismohumihingiwondersiradeletingmarsosigniskedyulpunsocapitalikawkailanganeffektivpalapitkontingtinanggapfar-reachingheheattentionkailanbatomassespootstartedexplainhellotransitkamandagmakapalbusyangmasksamfundlamesacontestbabesasimdalawcupidpanaybinawisinapaktaingabukodomginiwanmaestrosaidliv,makasilonggirl