Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

2. It is a versatile dish that can be customized with various fillings and toppings.

3. Ibinigay ko na ang lahat ng makakaya ko upang matulungan ka.

4. ¡Buenas noches!

5. Nagkapilat ako dahil malalim ang sugat ko.

6. Ano ang gustong sukatin ni Andy?

7. Kumaripas ng takbo ang aso nang makita ang paparating na sasakyan.

8. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

9. Mawala ka sa 'king piling.

10. Claro, haré todo lo posible por resolver el problema.

11. Disse inkluderer terapi, rådgivning og støttegrupper.

12. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

13. Baby fever is a term often used to describe the intense longing or desire to have a baby.

14. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

15. Madalas lasing si itay.

16. El realismo y el impresionismo son estilos populares en la pintura.

17. Lumakad sa kalye ang mga kabataan nang limahan.

18. Ang kuripot ng kanyang nanay.

19. Dun na nga raw pala tayo dumeretso sabi ni Tita Andrea.

20. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

21. Nakakaanim na karga na si Impen.

22. The event was sold out, and therefore we couldn't get tickets.

23. The potential for human creativity is immeasurable.

24. Las suturas se utilizan para cerrar heridas grandes o profundas.

25. Peace na tayo ha? nakangiting sabi niya saken.

26. Nagtaas na naman ng presyo ang gasolina.

27. Tobacco was first discovered in America

28. The news might be biased, so take it with a grain of salt and do your own research.

29. Magtanim na lang tayo ng puno para makatulong sa kalikasan.

30. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

31. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

32. Payat at matangkad si Maria.

33. Lakad pagong ang prusisyon.

34. A lot of traffic on the highway delayed our trip.

35. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

36. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

37. Natapakan ako ni Juliet habang sumasayaw.

38. Ngunit nagulat ang lahat sapagkat mul sa maruming ilog ay may maliliit na insektong lumulusob sa bayan tuwing gabi.

39. Dali-daling umalis ang binata patungo sa palasyo.

40. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

41. Mayroon ba kayo na mas malaking size?

42. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

43.

44. The momentum of the economy slowed down due to a global recession.

45. Microscopes are also used in materials science and engineering to study the microstructure of materials.

46. Kapag may isinuksok, may madudukot.

47. Mabilis siyang natutunan ang mga bagong teknolohiya dahil sa kanyang natural na abilidad sa kompyuter.

48. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

49. El que mucho abarca, poco aprieta.

50. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

Similar Words

popularize

Recent Searches

disposalpopularsinapakbataykantoibigmahahabamakisigmorenakagatollamangbatipitakanuonsystematiskexamscientifictuladferreraddconsiderarnutrientesstrengthdragonchangestrategydatapwatcigarettesabipingganroonstyrerableannacreatingstreamingcrosscleanpanggatonglamesananagupangmrsnegrosnapatunayanbayaankalaunanmahalnangtulalabathalaimagingasinpaligidpasanbansangnaantigmalalakidiferentesnasagutangawainkunwakinikilalangnagandahannakatuwaangpagkalipaskapangyarihangjobsnahuhumalingdapit-haponnaupomakahirampagkalungkotnagkitanapakamisteryosokinakitaanpresidentialikinamataymovieskinamumuhiantemperaturakakutismakapagempakemaghahabimanirahansulyapromanticismomagtataasmagpagalingnageespadahandidingnanatiliyumuyukomalambotforskel,lalakadmananakawkatuwaanthanksgivingnapatigilmaipapautangmangahasmakikitulogmetodiskakmangnahantadhistoriaasukalidiomakablanadvertisingcurtainsandreainitninyongtuwang-tuwafiverrsaleshimayineffort,jagiyaasiaticpeppypamanapologeticsuwailnararapatadoboilocosdibalegacylarongnakitapierskypenunogoodeveningkalakingsadyangsinabiuncheckedrosefeedback,billbinigayweddingtoobinabaanharmfulfuncionariconlulusogtechnologiespackagingbroadcastsipihitrolledlightchinesekumakapitmakakakainagilityiniresetamarketing:beenovernaghanapnapatungolumahokpag-itimkumakantabawalreplacedpanunuksolilimtrafficnag-isipmalayapakelameronakatindigmensahetumutuboeleksyonproducerermagingikinabitnaguguluhangbalediktoryanmiyerkolesnag-oorasyontinapayngipinginteresttelevisednag-iinomprovidedmanamis-namisnanghahapdinagliliwanagikinabubuhay