Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Maarte siya sa kanyang hitsura kaya lagi siyang nakabihis ng maganda.

2.

3. Naglakbay siya sa ibang bansa upang hanapin ang hinugot niyang inspirasyon.

4. Ang aking kaibuturan ay nababagabag sa mga pangyayari sa mundo ngayon.

5. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

6. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

7. Guilty. simpleng sabi niya saka ngumiti ng malapad.

8. One of the most significant areas of technological advancement in recent years has been in the field of communications

9. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

10. Ayaw kong sumakay ng bus kung minsan.

11. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

12. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

13. Marami siyang ginawang pagkakamali sa proyekto, samakatuwid, hindi ito natapos sa takdang oras.

14. Bagsak ang ekonomiya ng Pilipinas matapos ang nangyaring kaguluhan.

15. Pero kahit marami ang sumunod sa itinuturo ng paring Espanyol ay may isang barangay na bulag pa ring sumasamba sa mga anito.

16. Les crises financières peuvent avoir des répercussions importantes sur l'économie mondiale.

17. Les jeux peuvent également dépendre de la chance, de la compétence ou d'une combinaison des deux.

18. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

19. Superman possesses incredible strength and the ability to fly.

20. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

21. Nationalism has played a significant role in many historical events, including the two World Wars.

22. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

23. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

24. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

25.

26. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

27. Nakapila sila sa kantina nang limahan para maging maayos.

28. Pinalitan nya ng diaper ang umiiyak na sanggol.

29. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

30. Practice makes perfect.

31. Samahan mo ako sa mall for 3hrs!

32. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

33. Recycling and reducing waste are important ways to protect the environment and conserve resources.

34. Nagsusulat ako ng aking journal tuwing gabi.

35. El mal comportamiento en clase está llamando la atención del profesor.

36. Mathematics can be used to optimize processes and improve efficiency.

37. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

38. Eine Inflation von 2-3% pro Jahr wird oft als normal angesehen.

39. Walang kagatol gatol na nagsalita ang lalake laban sa kanyang amo.

40. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

41. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

42. In conclusion, the telephone is one of the most important inventions in human history

43. Isang magnanakaw ang nagsanib-puwersa upang mabuksan ang vault ng bangko.

44. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

45. Marami ang nagdadasal sa simbahan tuwing linggo.

46. Las hojas de mi planta de menta huelen muy bien.

47. Mabuti naman at nakarating na kayo.

48. La science est la clé de nombreuses découvertes et avancées technologiques.

49. Nasa ilalim ng silya ang payong ko.

50. Ang mga pag-aaral sa kalusugang pang-mental ay nagbibigay-diin sa kahalagahan ng kamalayan sa mga isyu ng mental na kalusugan.

Similar Words

popularize

Recent Searches

popularwaripatiencedepartmentmagisipanimenumagsugalparanglearningmababawsitawkarangalanincidencenahigamatarayhomeriyankananpanindangkatagalandeletingbigongisamasineskyldespangkatituturonenakirotpagkamanghapapanhikpapagalitankikitaalas-diyesnagmamadaliwalkie-talkienagsisipag-uwiannanghihinamadpinagpatuloynagkitataga-nayonmalezavirksomhedermaipantawid-gutomkargangforstålazadaparehasnanayanghelsinungalinglasatasabinibilikenjibuhokrabbapinatirasalbahebisikletajennytanganadecuadobobotokamaonabighanikaharianpinapalocancernasiranagtataasnaguguluhannaibibigaymakatatlonagmadalingflyvemaskinermiranapaiyakdoble-karasaritahumiwalayemocionantekarununganbloggers,opgaver,pacienciamakaraanhimihiyawtinakasanmasasayahulunapapahintobagsakkatuwaanmananakawpaghaharutanpakakatandaannaliwanaganmagkakaroonnagbantaybabasahinkasiyahankalaunanmakikiligoperpektingmaanghangkatutubopuntahaniniindavideosnapasubsobnapuyatnapatigilnakangisinglabinsiyamwatawatmagbibiladtumawamagtigilyumabangkuryentetotoongnauntogde-lataisinamasunud-sunodniyonatakottiemposumokaymakisuyonaawaitinaassarisaringnapawisocialesrespektivetiyakinlovebinitiwangovernorsperopakaininalaganatayopatongtayocandidatesnapashadesminahancityampliadalawangmanonoodumigibmagtanimpangalananeconomicmungkahipisaraexcuseclasesbagobisigshopeenoosamakatuwidcanadatakespinatidsalarinuulitsantoayoncalciumweddingnagbasabilugangsuccesssnapoongaabothitiksipamukainiinomvalleydahantagalog1954lifepanopriestsumakaysemillasltopasigaweclipxe