Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. She exercises at home.

2. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

3. She has finished reading the book.

4. Alam mo ba kung bakit takot si Cross sa hospital?

5. Sino ang kasama ng ate mong naglakad kahapon?

6. Anong kulay ang gusto ni Elena?

7. She joined a charitable club that focuses on helping the elderly.

8. Las hojas de té son muy saludables y contienen antioxidantes.

9. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

10. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

11. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

12. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

13. Mahirap kausapin ang mga taong maarte dahil sa kanilang pagiging kritikal sa bawat bagay.

14. Mababa ang marka niya sa pagsusulit dahil hindi siya nakapag-aral.

15. Nag-pout si Mica saka kumapit sa braso ko.

16. Ang tunay na kaibigan, sa hirap at ginhawa ay kasama.

17. The telephone has undergone many changes and improvements since its invention

18. Dahil sa magigiting nating bayani, nakamit natin ang araw ng kalayaan.

19. Naku, may boyfriend ako eh. sabi ko.

20. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

21. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

22. "Dogs are not our whole life, but they make our lives whole."

23. Sa loob ng simbahan, nararamdaman ko ang isang matiwasay na kapayapaan.

24. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

25. La película que produjo el estudio fue un gran éxito internacional.

26. Naging espesyal ang gabi ng pamamamanhikan dahil sa pagtutulungan ng dalawang pamilya para sa nalalapit na kasal.

27. Ang tunay na kayamanan ay ang pamilya.

28. Hindi ko naabutan ang dakong huli ng pagbubukas ng tindahan.

29. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

30. Yung totoo? Bipolar ba itong nanay ni Maico?

31. Gaano siya kadalas uminom ng gamot?

32. Bilang paglilinaw, ang event ay para sa lahat, hindi lang sa mga miyembro ng organisasyon.

33. Puwede bang makausap si Maria?

34. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

35. Congress is divided into two chambers: the Senate and the House of Representatives

36. Gusto pa niyang magbalik sa sulok na kanyang higaan.

37. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

38. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

39. The pretty lady at the store helped me find the product I was looking for.

40. Musk has been described as a visionary and a disruptor in the business world.

41. Ant-Man can shrink in size and communicate with ants using his helmet.

42. Hindi dapat tayo gumamit ng marahas na wika sa mga pag-uusap.

43. Hindi pa nga ako nagtatanghalian eh.

44. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

45. You may now kiss the bride. Sabi nung priest.

46. It’s risky to rely solely on one source of income.

47. May I know your name so we can start off on the right foot?

48. Bahay ho na may dalawang palapag.

49. Lumipad palayo ang saranggola at hindi na nila nakita.

50. Dogs are often referred to as "man's best friend".

Similar Words

popularize

Recent Searches

iyanpasigawpopularkinantaiyon1950sbangkohappenedbilibsetyembrenaglabananmulighederpsssyourself,broughtsystematiskspeechesprimeraccedergisingmedievalsuffermagpuntabossafterleorabemadamilutopropensobanglordfuelremainbinawituwangfastfoodplanspeechyoncandidateviewshalikaeducationaldaigdigtiposhowevermetodeadventidea:kilofaultpinalakingtvsbusnamehititimstrengthstonehamamountconventionalnausalkahaponabstainingkaringprospertransparentyanmarchdilapookchaditakbipolarlarryfertilizermoodbumababaconvertidasfreelancerleukemianilangcallerdalandanhydeldisappointnicerobertimpactedbeyondfeedbackinternalregularmenteprotestarecentkitnerissaneedprovidedechave1982evilflybadinghimselffigureclientesdebatessecarsepeer-to-peerprogramaulingneedssyncgenerateddedicationmitigatemediumentrymessageclassmateayanfallasocietypracticessasabihingenerabalearnelecteduniquealignsgoingnegativeentercircleothersspaghettimaglarobaomakidaloopgaver,magkikitanagtutulaknananalodagatnohpinag-aaralandoble-karanahihiyangmagpakasalmagulayawkaharianbumibitiwnapanoodpunongumiwimakatulogpagtinginnakabawimaramotimpactlawamanilanararamdamaniloilonasiyahanbayawakkumidlatculturalinternetshopeemansanasblusaIbabapagtatanimmakakawawaseguridadtumunogpasyentekongresoincluirnaghihirapmagdamaganroboticsmagkanokumampiyumabangnatatawabuwenasmarvinlungsodperyahanpaanonatinagpinalalayashumampasanimgarbansosnews