Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Kailangan mong supilin ang iyong galit upang makapag-isip nang maayos.

2. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

3. Agama sering kali menjadi sumber inspirasi dan motivasi bagi individu dalam menghadapi tantangan hidup dan mencari makna dalam eksistensi mereka.

4. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

5. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

6. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

7. El agua potable es fundamental para mantenernos hidratados y saludables.

8. Nakatingin siya sa labas ng bintana, waring may hinihintay.

9. They are not considered living organisms because they require a host cell to reproduce.

10. Tumulo ang laway niya nang malaman na may magandang balita siyang natanggap.

11. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

12. Ang utang ay maaaring maging mabuting paraan upang matugunan ang mga pangangailangan sa panahon ng kawalan ng sapat na pera.

13. Paano kung hindi maayos ang aircon?

14. Kailangan kong harapin ang aking mga agam-agam upang hindi ako magpakita ng kahinaan.

15. Kumusta ang bakasyon mo?

16. Minsan, inaasikaso ko ang mga bagay-bagay ng aking nililigawan upang maramdaman niya ang aking pag-aalaga sa kanya.

17. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

18. Ang lalaki ng paniki na aming nakita.

19. Transkønnede børn og unge skal have adgang til støtte og ressourcer til at udforske deres kønsidentitet i en tryg og støttende miljø.

20. Maaaring magdulot ng pangmatagalang epekto sa kalusugan at kaligtasan ng mga tao ang digmaan.

21. Mabuti na rin ang nakatapos ng pag-aaral upang pagdating ng panahon ay magagamit mo ito.

22. Pasensya na, kailangan ko umalis ng maaga.

23. Ang pagmamahal at pag-aalaga ng aking kabiyak ay nagbibigay sa akin ng kasiyahan at kaligayahan.

24. Si Lolo Pedro ay pinagpalaluan ng kanyang mga apo dahil sa kanyang mga kwento at payo.

25. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

26. Hindi dapat natin kalimutan ang ating mga responsibilidad, datapapwat ay may mga pagkakataon na napapabayaan natin ito.

27. Pagkain ko katapat ng pera mo.

28. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

29. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

30. Kailangan nating magplano upang mas mapadali ang pag-abot ng ating mga pangarap.

31. Nagpunta ako sa may kusina para hanapin siya.

32. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

33. La música también es una parte importante de la educación en España

34. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

35. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

36. Claro que puedo acompañarte al concierto, me encantaría.

37. "Kapag may tiyaga, may nilaga" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pasensya at pagsisikap upang makamit ang tagumpay.

38. Kung siya ay salamangkero, bakit hindi niya ginamit ang kapangyahiran niya sa akin?

39. A quien madruga, Dios le ayuda.

40. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

41. Ang pagiging malilimutin ni Peter ay hindi sinasadya; minsan ito ay dulot ng stress.

42. Wala siyang ginagawa kundi ang maglinis ng kanyang bakuran at diligin ang kanyang mga pananim.

43. Sumasakay ako ng taksi sa umaga araw-araw.

44. Elektronik kan være en kilde til underholdning og sjov.

45. Gusto ko ang mga bahaging puno ng aksiyon.

46. Ang pagtangging harapin ang mga hindi kanais-nais na katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

47. Hinabol kami ng aso kanina.

48.

49. Sa panahon ng tag-ulan, naglipana ang mga lamok sa amin.

50. En invierno, el cielo puede verse más claro y brillante debido a la menor cantidad de polvo y humedad en el aire.

Similar Words

popularize

Recent Searches

popularpaskongbateryadibakasaysayancompositoresambagchickenpoxpagputisusimakaratingagadmapaibabawjoepisokatandaanvelstandgrammarangkandalagangstonehamfansbeintelaylaygandateachmuchasagaabonomasdansulinganjoybulsaauditchamberscommunicationadvancedmabutingwriteduloipinalutogoingdeclareregularmentepotentialneeddebatestelevisedcheckstoolstabingvideos,maibabalikisinamaakmangbagongpagiisipalas-dosintyaincoughingnanoodtanggalintaong-bayanmataaspublicationhinogopotoothbrushjackzscientistngpuntadalawadinilightsallowedtiposwaitpatrickadaptabilitylumiwanagthingsmagpaliwanagmasayahinnapaiyakmalulungkotcorporationkaniyananigasbobotoarabiapatimaghihintayhumalonagkantahantawaannikasumimangotinventadopakisabidomingomagtipidincidencecolorsumabogtaun-taonpalikuranpagebitiwanbuwalluispasanskillinuulcerpalipat-lipatnaninirahannagmakaawalabing-siyamnamulatbestfriendpagdudugokusinerokasintahanyakapinnakataasmakukulaypaanopanalangininterests,jejuedukasyongawainbopolspakilagaypaki-drawingnilinistilingayoncalidadkubyertosdatimemorialdiaperbillcigarettehongpasokumiinitdevelopedfuncionardulakilongkamiassalbahengpanindahalu-haloseguridadmahiyaunti-untingdamdaminpromotingfeelingeksenaheienchantedadventmuchosbinabaanmataposhinihintaynasagutanmahuhulipumayagkaarawan,mahirapmaghahabinogensindematigasadditionally,salitangkumbentolalakekuwebamatitigassamfundseenatanggapwestpartylawsanimoycompostelaikinatatakotnakakapagpatibaypagluluksaenfermedades,magkaibigannagpakitanakapapasongpatutunguhanikinabubuhay