Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa paglutas ng mga palaisipan, mahalaga ang pag-iisip nang malikhain at pagpapakita ng kahusayan sa loob ng isang patlang.

2. El algodón es un cultivo importante en muchos países africanos.

3. International cooperation is necessary for addressing global environmental challenges, such as climate change.

4.

5. Sino-sino ang mga inimbita ninyo para manood?

6. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

7. Sa kabila nito, nanatili siyang aktibo sa politika ng Pilipinas pagkatapos ng pananakop.

8. No me gusta el picante, ¿tienes algo más suave?

9. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

10. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

11. Los granjeros deben estar atentos al clima para saber cuándo es el mejor momento para cosechar.

12. Bago siya ipinatay, si Rizal ay isang aktibistang politikal na lumaban sa korupsiyon at pang-aabuso ng mga Espanyol sa Pilipinas.

13. Hvis man oplever smerter eller ubehag under træning, er det vigtigt at stoppe og konsultere en sundhedsprofessionel.

14. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

15. Where we stop nobody knows, knows...

16. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

17. Nag-alala ako nang magdidilim na ang paningin ko habang nagmamaneho sa isang maulang gabi.

18. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

19. Frustration can be a normal part of the learning process and can lead to personal growth and development.

20. "Dogs leave paw prints on your heart."

21. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

22. Nais naming makita ang mga balyena sa malapit na karagatan.

23. Dumating ang mga kamag-anak ni Fe.

24. Tumango ako, you want? alok ko sa kanya.

25. Ang sakit niya ang nakapanghihina sa kanya.

26. Libro ko ang kulay itim na libro.

27. Parang kaming nageespadahan dito gamit ang walis at dustpan.

28. Las labradoras son conocidas por su energía y su amor por el agua.

29. May kailangan akong gawin bukas.

30. Hindi ko mapigilan ang aking inis kapag nakikita ko ang kawalang-katarungan.

31. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

32. Magtanim ka nga ng mga puno dyan sa garden.

33. Nous allons nous marier à l'église.

34. Di na niya makuha pang ipasok ang pisi ng beyblade upang mapaikot ito.

35. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

36. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

37. Limitations can be viewed as opportunities for growth and personal development.

38. Nasira ang kanyang sasakyan dahil sa isang aksidente sa kalsada.

39. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

40. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

41. Nagsisilbi siya bilang guro upang ituro sa kanyang mga estudyante ang tamang edukasyon.

42. Limitations can be physical, mental, emotional, financial, or social.

43. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

44. Pangako ng prinsipe kay Mariang maganda.

45. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

46. Umalis siya kamakalawa ng umaga.

47. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

48. Marahil ay hindi mo pa nakikita ang bagong pelikulang ito kaya't dapat mo itong abangan.

49. El amor todo lo puede.

50. Ang taong lulong sa droga ay parang nasa bangin na patuloy na bumababa hanggang sa wala na siyang mahawakan.

Similar Words

popularize

Recent Searches

popularkalupinotdoonkaawaymagkikitakikitamaawatangingjosephnatalonapabayaankamiaskiniliglinggonangahasbuwayapagkalungkothappynanlalamigalamkabuhayanatinthoughmayamantooipinadalagawaingniyangdatimasaktanrambutandecreasegenerosityeskwelahanhalikannakihalubilonatinagnathannagsisilbimabaliksandalikahapondenpnilitpangyayaringitobobdamdamincalambabesesikinabitmarahangraymondeksporterernakadapaburgernagkantahanhealthbukodpumuslitwalafeedbackkidlatangalpagtuloymagkaparehoherramientastunaymamarilkalabanbumilisocialkondisyoniyoncelularestugonkuwartoconventionalbigyanmagbibigaypagkakalapatpasinghalginawanagtagisankaibiganparinasaltigasmaibalikpag-uwistreetipihitvaccineswalisilankasiyahankontinentengbisikletatsupertinangkanakahugmabutingculturalhetomagbakasyonburolmabiromeansbalitahudyatsingernag-aasikasogiyeraanak-pawissumusulatsumusunodchunoutlinesbagamamahabapearlwaringfridaylawanagpapaigibmahalagakabiyakdeletingyouraplicarnohfacultyidinidiktapangulosampungnagbibigaykaguluhanyamanaccuracyhalainilingkatapatuniversetmangmabatongyelodaddypag-unladprinsesadoublewakastinulunganjeeprespektivesumunodpunong-kahoyhouseholdspagkapunomejofuncionesumiibigbilihinkamag-anakguroililibretumahanguidegumulongninaisfotoszoopagsambawanthabangsectionskatutubolalargamonsignorlangtayolugarnasuklamattorneypinalayaspingganiniisipmabuhaydosenangkasalananramonkamukhalasingeropanalanginbinulabogprobinsiyananlilisikmedya-agwapamilya