Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa aming bakuran, nagtatanim kami ng mga tanim na pampalasa tulad ng luya at sibuyas.

2. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

3. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

4. Matayog ang lipad ng saranggola ni Pepe.

5. Napapasabay din sa pagimbay ang mahagway na Kawayan kasama ang Pagong na nagbababa at nagtataas ng bahay-bahayan.

6. Umayos naman ako ng higa at yumakap patalikod sa kanya.

7. Ang daming pulubi sa maynila.

8. Ang pelikula ay ukol kay Jose rizal na lumaban para sa kanyang bayan.

9. Ang aming angkan ay mayroong mga tradisyon sa pagdiriwang ng mga okasyon.

10. Ang dalawang isinumpa ay namuhay sa kakahuyan.

11. Makapal ang tila buhok sa balat nito.

12. You're stronger than this, pull yourself together and fight through the tough times.

13. Ano ang pinakidala mo kay Sarita sa Maynila?

14. Il est tard, je devrais aller me coucher.

15. All these years, I have been building a life that I am proud of.

16. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

17. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

18. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

19. Nakaupo ito, taas ang kaliwang paa, sa dulo ng halos dumapa nang bangko.

20. Nagtagisan ng galing ang mga maghahabi.

21. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

22. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

23. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

24. Mabuti na rin ang nakatapos ng pag-aaral upang pagdating ng panahon ay magagamit mo ito.

25. J'ai acheté un nouveau sac à main aujourd'hui.

26. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

27. Ang salarin ay nagtago sa malalayong lugar upang makaiwas sa pag-aresto.

28. Sa kabilang silid, nagitla ako nang biglang sumigaw ang aking kaibigan.

29. Es importante educar a los jóvenes sobre los riesgos y peligros del uso de drogas.

30. Minsan lang ako nag mahal ng ganito.

31. The legislative branch, represented by the US

32. Pakibigay ng malinaw na paliwanag sa tanong upang mas madali itong maunawaan.

33. Las hojas de lechuga son una buena opción para una ensalada fresca.

34. Hindi ibibigay ng Panginoon sa iyo ang isang pagsubok kung hindi mo ito kaya, magtiwala at maniwala ka lang sa Kanya.

35. Isang Saglit lang po.

36. Limitations can be a source of motivation to push oneself to achieve more.

37. Si Pedro ay namamanhikan na sa pamilya ni Maria upang hingin ang kanilang pahintulot na magpakasal.

38. Microscopes can magnify objects by up to 1,000 times or more.

39. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

40. May isa pang nagpapaigib sa kanya.

41. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

42. Titira kami sa Banawe sa darating na panahon.

43. Maglalakad ako papuntang opisina.

44. Ang mga NGO ay nag-aapuhap ng donasyon upang matulungan ang mga batang ulila.

45. That article might not be completely accurate, so take it with a grain of salt.

46. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

47. Kailangan ng mas magandang kondisyon sa trabaho para sa mga anak-pawis upang mapabuti ang kanilang kalagayan.

48. Ang sugal ay isang hindi makabuluhang pamumuhunan na madalas nawawala ang ininveste.

49. Wag kana magselos, mahal naman kita eh.

50. La música es una parte importante de la educación musical y artística.

Similar Words

popularize

Recent Searches

popularsamfundkerbplacemalapadmadamigamotreboundfuelultimatelysinagotbukodpopularizehidingdangerouslandofonosipapaputolneabuongdapatnasusunogpunong-punomagkasabaysumindimoodnilangboksingipanlinismesangtoncryptocurrencyexamellawatchuriprofessionalfridaymurangmuchascuentanaalispasswordfaulttopic,palagingspaghettipresscoachingagilityconcernsnapatigilnasundobadingcommunicateextranaiinggitcandidateadditionallypossibleelectronicemphasizedspecificpracticesclienteadaptabilitybasaoftenrobertano-anotumatanglawkatamtamannaninirahandatugandahantumalonkuripotpaglingafameprincipalesflamencogamitverybusiness:pinalambotmusictawagsumisidpacefredcrucialusomagkamaligrankampeonmayapaggawamagawangpamasahemanunulatipipilitpwedetomarhapontotooitinulosbilanginbluenakasakitlarolalaabalaadicionalespagawainjokekamatislargerzoommasdantendereventsritobroadcastboboeffortsnabubuhaypupuntahantinangkanapatayomasayahinnamulaklakalas-diyeskumikinignaupokumukuhanagkakatipun-tiponmerrypinakamatapatmumuranagre-reviewmakakasahodnagsisipag-uwiannagbabakasyonnagpapasasamarketplacesbangladeshmagpa-ospitalkanya-kanyangbehaviorexhaustionnahintakutanmagkaharappinamalaginaabutanimpornahihiyangflyvemaskinerbumibitiwisinagotisinuotkakutiskaramihansagutintungkodcorporationsabihinarbularyopagkaawanagkasakitmakuhamedicalmalulungkotmagsasakapacienciatinaymedikalhimihiyawinlovepropesornabigkaspagbibirosisikatpakukuluansinisiranagbibirokisapmatasapatosescuelasbinabaratnakakapuntavegasmatandangaayusinmasungitumokayisinaranatuyoeffort,napilitangkaragatan