Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Minabuti nilang ilihim nila ito sa kanilang anak.

2. A lot of laughter and joy filled the room during the family reunion.

3. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

4. Isang mahigpit na tunggalian ang naganap sa gitna ng kabanata, na nagbigay daan sa pagbabago ng landasin ng kuwento.

5. Sa daan pa lamang, bago siya pumasok ng tarangkahan, ay natatanaw na niya ang kanyang anak na dalaga na nakapamintana sa kanilang barung-barong.

6. Nagpunta sa kumbento si Sister Jane.

7. Sa paglalakad sa gubat, minsan niya ring naisip na masarap maglakad nang nag-iisa.

8. Hindi ka ba napaplastikan sa sarili mo, tol?

9. I am reading a book right now.

10. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

11. Masipag manghuli ng daga ang pusa ni Mary.

12. A father's love and affection can have a significant impact on a child's emotional development and well-being.

13. Iparating mo ang mensahe sa mahal na hari.

14. Sa araw ng pamamamanhikan, dala-dala ng pamilya ng lalaki ang mga handog para sa pamilya ng babae.

15. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

16. No puedo controlar el futuro, así que "que sera, sera."

17. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

18. Hinding-hindi napo siya uulit.

19. Ano ang ginawa niya pagkatapos ng giyera?

20. Nice meeting you po. automatic na sabi ko.

21. A couple of actors were nominated for the best performance award.

22. Nag-aral ako sa library kaninang hapon.

23. Di nagtagal, muli niyang naramdaman na tila nangangalirang na naman ang kanyang balat.

24. Doa juga bisa dijadikan sarana untuk memohon kesembuhan dan keberkahan atas orang yang sakit.

25. I am absolutely committed to making a positive change in my life.

26. Ils ont déménagé dans une nouvelle maison récemment.

27. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan.

28. Kanino humingi ng tulong ang mga tao?

29. Mas mainit sa Pilipinas kaysa dito.

30. She donated a significant amount to a charitable organization for cancer research.

31. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

32. Alay ko sa iyo ang bawat sandali ng buhay ko.

33. Ang bukas palad na pagbibigay ay hindi palaging tungkol sa pera, pwede rin naman itong mga bagay na hindi nakakalat.

34. Inaamin ko rin na kulang ang aking nalalaman.

35. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

36. Dumadating ang mga guests ng gabi.

37. Ang mga bayani ay mga taong nagsakripisyo para sa kalayaan at kabutihan ng bayan.

38. The lightweight construction of the bicycle made it ideal for racing.

39. Mila Romero ang pangalan ng tiya ko.

40. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

41. Les salles d'hôpital sont souvent partagées entre plusieurs patients.

42. Hockey is played with two teams of six players each, with one player designated as the goaltender.

43. He was already feeling sad, and then his pet passed away. That really added insult to injury.

44. Natawa na lang ako sa magkapatid.

45. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

46. The company used the acquired assets to upgrade its technology.

47. Ada udang di balik batu.

48. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

49. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

50. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

Similar Words

popularize

Recent Searches

pakibigyanpopularinfluentialsarabosestuladsilahatinggabidalaconocidosbalikcareertiboknageespadahanmakikipagbabagtignanbevareimprovetuktokkarnabalabonorollednagplayfeelingpagpapakilalakumidlatyoninfectiouskalakingumibigsiguromagkasinggandacadenagamebalathoweverpacepinalakingilongnakatapatmaghaponmabihisannakasakitlinamarurumiinsteadactorreserbasyontotoongmatabanghitikkargahanelectoralmagbibigaypakibigaydinaananinulitumulannuevofatpnilitnaantigyumanigperlakontratalistahanipinanganakgumagamitnasisiyahanmurang-murapakisabinatagalantumalonipantalopmisyunerongmaglaromakisuyoexpertumuusighitnananaghilimawalasunud-sunodterminonabigyansagasaanlalakadmauntogprotestadisenyomodernsikipiniibignaglalakadresortginawaranpinunitsumapitnag-iisaipihitpepesasayawinsequetomorrowtinderaasukallamesanahuhumalingmangmasyadongumarawbilingsasapakinbugtongnagbibigayprogramminglumalangoyprocessnasirapinapakainnagtutulunganitopandalawahanisipstringkaytusongbisitalungkotambaawitinniyonnohtaxinagbasasalarinkamisetanghampaslupasumubokawalanhimutokpopulationkampotumaliwascomefathernanlilisikpangambapakilagaynanaogtatlongalitaptapbalikatupuanpictureskuyabagongbagamatiniresetakusinagloriasubject,kasamaannagpipiknikvitamindibahelenapinagmamasdannakainnagpapasasakagubatannewskampeonasiaticpornakakatulongarghlupakasalananandreanagngangalangparangmaghandaforcesumiinommahabangrawinventionsinongpinyaditopaghihingalofriesatinschoolrecentlypagkahapodiferentesnangingisayknown