Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ikinagagalak kong makilala ka, Maria.

2. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

3. Protecting the environment requires a collective effort from individuals, organizations, and governments.

4. Nakakasama sila sa pagsasaya.

5. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

6. Kailangan natin ng mga kubyertos para makakain ng maayos.

7. Nahuli ng guwardiya ang magnanakaw habang ini-inspect ang kanyang bag.

8. Los efectos a largo plazo del uso de drogas pueden ser irreversibles.

9. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

10. Walang pagtutol sa mga mata ng mga ito.

11. No puedo preocuparme por lo que pueda pasar en el futuro, solo puedo confiar en que "que sera, sera."

12. Ang pag-aaksaya ng pera sa sugal ay isang hindi maipapaliwanag na desisyon.

13. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

14. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

15. "A barking dog never bites."

16. Ang lilim ng kanyang mga braso ay nagbigay ng komportableng yakap sa kanyang mga apo.

17. Saka dalawang hotdog na rin Miss. si Maico.

18. Si daddy ay malakas.

19. Sa pamamagitan ng isip ay pinaglagablab ni Tarcila ang barko ng mga pirata.

20. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

21. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

22. Maruming babae ang kanyang ina.

23. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

24. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

25. Nagtataka ako kung bakit hindi mo pa rin maipaliwanag sa akin kung ano ang totoong dahilan.

26. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

27. Bawat isa sa atin ay may malalim na koneksyon sa lahat ng ito, sapagkat ang panitikan ay bahagi ng kultura at buhay ng bawat isa sa atin.

28. From its early days as a technology for the elite, to its current status as a staple in most

29. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

30. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

31. Hindi mo alam ang kanyang tunay na nais dahil hindi mo alam ang kanyang kaibuturan.

32. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

33. Maaaring magdulot ng stress at takot ang pagpunta sa dentista, ngunit mahalagang malampasan ito upang maiwasan ang malalang dental problem.

34. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

35. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

36. Nasa labas ka ba? Teka puntahan kita dyan.

37. In 1977, at the age of 42, Presley died of a heart attack

38. Climate change is one of the most significant environmental challenges facing the world today.

39. Nagsmile siya sa akin, Bilib ka na ba sa akin?

40. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

41. Ang pagsama sa kalikasan ay nagdudulot ng isang matiwasay na kalooban.

42. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

43. Hindi ko maintindihan kung bakit kailangan ko pang magtiis sa ganitong sitwasyon.

44. Ang albularyo ang tumulong sa pamilya para maalis ang sumpa sa kanilang lupa.

45. Sa di-kawasa ay dumating ang malungkot na sandali.

46. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

47. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

48. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

49. Dumating ang pangulo sa pagtitipon.

50. Ang "sa ganang iyo" ay ginagamit upang ipakita ang pansariling pananaw o opinyon ng isang tao sa isang partikular na isyu o sitwasyon.

Similar Words

popularize

Recent Searches

populartanodk-dramaliigkakaingreatbibisitanagbanggaanerhvervslivettrabajarproducelikuranebidensyamadamotnatuloginatupagiphoneonlyaparadorcramesakindarkvasquespinilingipipilitprosesomakangitiespecializadasnangangahoyflightpollutionstoresoonpowerhigantehouseholdkumampimerrygraphicnaghandanginiinomiiklibangladeshpagbabagong-anyopasahevenusnaibibigaynaguguluhanrevolutioneretcultivationdiwatakapasyahanpangungusapnaguguluhangmagkasakitmakasalanangbwahahahahahahawlasisentanaiinismaya-mayaitsuranyanpinoymatesabarcelonamag-inadefinitivokaano-anoproductskulangkarangalanprutasanitokinainginaganoonhangaringchaddream1000kubyertosniceapollorelievedpeterenterpapanigkapatawarannapagtantotinatawagmababasag-ulotaga-tungawtools,kungnangangalitkatapatmabigyansequediyosamagtipidbaglangeksaytedcantidadhalatangnagre-reviewewanpatulogfuncionesopdeltnagsilabasanhinagpislunesexhaustednamuhayitinindigeducatingmiyerkolesbentangkabangisanprinsesangnecesitaiwasiwaspaghugosamerikamahahalikmakisigcomunicannunowashingtongawan1954sonidosandokrepublicugaligulaylugawbisitanareklamovillagenagcurvekampomakikikainpaanongkanluranfavoryouthnapuyatyumuyukokaibiganmakakabalikbuksanpaketeguerrerosteamshipskarapatangtumapossiyudadnaaksidentealas-dosorasaniboncedulanag-aasikasoemailexperts,andoynewspapersbutaslupainindependentlybaguiowikaproducts:bandamatamanmaalwangsilajobartistiwasanmagkipagtagisanbestfriendpinagkiskisikinamataydadalawinposporospiritualikinabubuhaypagkalungkotpinakamahalagangnakipagtagisankerbpagtatakanagsineedukasyonculturastabingparts