Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Nagsisilbi siya bilang doktor upang mapangalagaan ang kalusugan ng kanyang pasyente.

2. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

3. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

4. Nakarating kami sa airport nang maaga.

5. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

6. He missed his flight and then his luggage got lost. That just added insult to injury.

7. A veces tengo miedo de tomar decisiones, pero al final siempre recuerdo "que sera, sera."

8. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

9. Mahabang pangungusap ang isinulat ni Lito sa pisara.

10. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

11. Bumilis bigla yung tibok ng puso ko.

12. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

13. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

14. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

15. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

16. Sa larong sipa, ginagamit din nila ang maliit na bola ng goma.

17. La science est la clé de nombreuses découvertes et avancées technologiques.

18. Kailangan kong lumakas ang aking loob upang maalis ang aking mga agam-agam sa aking mga pangarap.

19. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

20. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

21. Mathematics is an essential subject for understanding and solving problems in many fields.

22. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

23. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

24. She opted for a lightweight jacket to wear during her morning run.

25. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

26. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

27. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

28. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

29. La conciencia nos ayuda a ser responsables de nuestras acciones y decisiones.

30. Doa juga bisa digunakan sebagai sarana untuk meminta keberanian dan kekuatan menghadapi tantangan hidup.

31. Ang guro ko sa agham ay mahusay sa pagpapaliwanag ng mga konsepto.

32. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

33. Isang linggo nang makati ho ang balat ko.

34. Nakuha ko ang aking inaasam na sapatos kaya masayang-masaya ako ngayon.

35. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

36. Sino ang bumisita kay Maria?

37. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

38. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

39. Wolverine has retractable adamantium claws and a regenerative healing factor.

40. Good things come to those who wait

41. Uuwi si Ellen sa Cebu sa Pasko.

42. Gusto ko hong magpapalit ng dolyar.

43. Dahil sa pagkahapo ay nahiga siya sa lilim ng punung-kahoy para magpahinga.

44. Bakit mo siya binilhan ng kurbata?

45. Mula sa kinatatalungkuang giray na batalan, saglit siyang napatigil sa paghuhugas ng mumo sa kamay.

46. Ano ang gustong sukatin ni Elena?

47. La realidad es que nunca sabemos lo que nos depara el futuro.

48. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

49. Ang pagiging maramot sa pagmamahal ay hindi magdudulot ng kasiyahan sa buhay.

50. Agad agad din syang tumalikod at tumakbo...

Similar Words

popularize

Recent Searches

popularconsumekumukuloangkanparkekinainbumotowealthdevelopcivilizationtwo-partyisipasimmakasilongmanakboisulatpaglalayagemocioneshinamaktindahanpaaralanhumihingimbricosgagamitniyogbutimagalitbirthdaybighanipadalase-commerce,magisingtinikmantalinosteamshipstalagangxviipumikithiramniyonawitankalaroconvey,umuposandwichskillsnatatanawconclusion,promisetagumpaytiniklinggawingisinamatelephonechristmasbumalikbanalestadoskundimangumisingmabibingiriegabinabaratbook,observation,undeniablekumainkatibayangbiglaanincredibleeconomicherramientastagalgustongvegassahigdyosasementobawatsocietymahigpitperseverance,tuwidgandacontent,lungsodahhhhpangakovariedadhinampasnapahallayonmalayabiggestmalinisheymensajespagkakapagsalitapapuntakayang-kayangadvertising,gabi-gabitinatawagnag-aalangannananaginippagka-maktolnalulungkotkadalagahangmagpa-checkupnapakatagalpaglapastanganiloilopagsisisicrucialpagpilibumibitiwmakapalagnegro-slavesinvestingnakikianandayanalakiaplicacionesmawawalanovellespagkasabipambahaykatuwaanstrategiespanalanginngpuntaleaderspacienciapinagawamedikalproductividadforskel,nakakatandanangangalitairportkahuluganmatagpuanmedicaldiwatasinasabimanatiliarbejdsstyrkemakikituloggumawamakakibohayaanpinapataposmakaraanpawiindisfrutarsinaliksikseguridadumuwimagpagupittangeksmakasalanangyakapinactualidadumakbayasawaimportantenapapansintumiranami-misstumalimmaipapautanglinggongkisspamilyaclientesstylesresourcesdarkmichaelsarilingissuesserabslivebagipagtimplacorrectingstatepowersbadingmonetizingroquesteerdebateswouldbehindevensomecorner