Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

2. Nanalo siya ng Palanca Award para sa panitikan

3. Bawal magtapon ng basura sa hindi tamang lugar dahil ito ay maaaring magdulot ng sakit at katiwalian.

4. Ang laki ng bahay nila Michael.

5. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

6. Eine hohe Inflation kann das Vertrauen der Menschen in die Wirtschaft und die Regierung verringern.

7. Nasa likuran lamang niya ang nagsalita.

8. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

9. Mabilis ang takbo ng pelikula.

10. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

11. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

12. Practice makes perfect.

13. Anong tara na?! Hindi pa tapos ang palabas.

14. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

15. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

16. Kahit ang diyosang si Venus ay walang panama sa kaniya.

17. Pinagsisihan niya ang mga desisyon na hinugot niya mula sa kanyang emosyon.

18. Kumaripas ng takbo ang aso nang makita ang paparating na sasakyan.

19. I'm on a diet, but I couldn't resist having a small slice of cake.

20. Estudyante sina Rita at Fe sa UP.

21. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

22. Les impôts sont une source importante de revenus pour l'État.

23. Nagsisilbi siya bilang volunteer upang magbigay ng tulong sa mga nangangailangan.

24. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

25. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha revolucionado la forma en que las personas se comunican

26. Nagkapilat ako dahil malalim ang sugat ko.

27. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

28. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

29. Excuse me, may I know your name please?

30. Nationalism can be a source of conflict between different groups within a nation-state.

31. Les personnes âgées ont souvent des problèmes de santé chroniques qui nécessitent une attention particulière.

32. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

33. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

34. Kumain na kami ng tanghalian kanina.

35. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

36. Las suturas se utilizan para cerrar heridas grandes o profundas.

37. Nagsusulat ako ng mga kwento at mga katha upang palawakin ang aking imahinasyon.

38. Ang mga indibidwal na may marahas na asal ay maaaring humantong sa pagkakasangkot sa legal na problema.

39. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

40. Salatin mo ang prutas para malaman kung hinog na ito.

41. Pantai Kuta di Bali adalah salah satu pantai terkenal di dunia yang menawarkan pemandangan matahari terbenam yang indah.

42. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

43. Ang boksing ay isa mga sa sports na kinahuhumalingan ng mga Pilipino.

44. Matagal akong nag stay sa library.

45. Sa paglutas ng mga palaisipan, mahalaga ang pag-iisip nang malikhain at pagpapakita ng kahusayan sa loob ng isang patlang.

46. A couple of goals scored by the team secured their victory.

47. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

48. Le livre que j'ai lu était très intéressant.

49. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

50. Gawa/Yari ang Tshirt sa Tsina.

Similar Words

popularize

Recent Searches

popularpasanedukasyoninvestkakaroonmamanuganginggobernadortalino1950ssteertumatakboumokaykaytrajesanasviolencematalikngunitkilalang-kilalanagtatanimnilalangellaalemagigitinghundredulitipinanganakkinikitakaninosundaloroonriyanhousetechnologicalbasuraislakagipitanwishingkabiyakpamilyakamatiswashingtonforcesnapatulalaiwannakabiladespadachavittumalabkalalenguajexviieksportererubodiniswebsiteleftcorrectingganoonnaghuhumindigesténag-usap1980paladcomputerstruggledasukalelectoralgeneratedmakauuwinitoperopapuntaupuankumantamalalapadangkannangapatdankayabookskalawangingshapingpigingtaopalayomagnanakawpanguloiyamotaudio-visuallynagpanggapinaasahanganidchickenpoxpagkakilanlanmandukotyarihalamangtowardsbatangdiedriegaipinagbabawalmagsabientertainmentanitosmokerukol-kaynagpasyanakataasnutrientestransparentkabibiumagawestiloskotselarawansukatinpamasaheinventionestasyonhinahangaanlikeshojaskabinataannakakapuntatahanantigaspang-araw-arawimpormalapitprotestaparaisodumilimnagwelgahallantokterminokundimankinabukasanrobertmateryalestiniradorkuwartobabybalikatpaghangacupidtondomatabangpeacebarangaypagpapatubobangkakasamanagpipiknikpintuanisangsugaldurinahulitatawagagosmenosmapuputiauthornag-uwimaghandaintroducepagbisitangpuntaaccederklimanerosnapapalibutanauditconsiderarprogramming,putingnagpipilitmagulangsurgerynagbanggaannakagalawnatagalannapakamisteryosomobilitydintasaamericanpagitannakatagohabitdisensyopapayagpartbigaydiyaryobisitakarangalannabagalan