Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sapagkat misyunero, marami ang naliwanagan sa katotohanan.

2. Gusto kong hiramin ang iyong cellphone para tawagan ang aking kaibigan.

3. El diseño inusual del edificio está llamando la atención de los arquitectos.

4. Hindi niya inaasahan na mag-iwan ng malaking marka sa kanyang komunidad ang kanyang paglilingkod.

5. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

6. Frohe Weihnachten! - Merry Christmas!

7. Sadyang mapagkumbaba siya kahit na siya ay mayaman.

8. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

9. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

10. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

11. Tantangan hidup adalah kesempatan untuk belajar, tumbuh, dan mengembangkan ketahanan diri.

12. Therefore, we should all steer clear of this bad habit of smoking cigarettes

13. Inilabas ng pulisya ang larawan ng salarin upang matulungan ang mga sibilyan na makakilala sa kanya.

14. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

15. Hindi ako nakatulog sa eroplano.

16. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

17. Me siento caliente. (I feel hot.)

18. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

19. Los niños son propensos a sufrir de tos debido a infecciones respiratorias comunes, como el resfriado común y la gripe.

20. Salatin mo ang prutas para malaman kung hinog na ito.

21. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

22. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

23. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

24. Erfaring har vist mig, at det er vigtigt at have en positiv tilgang til arbejdet.

25. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

26. All these years, I have been working to make a positive impact on the world.

27. Siya ay kilala sa kanyang magalang na pag-uugali kahit sa mga hindi niya kakilala.

28. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

29. Sa dami ng nagnanais kumuha ng kursong iyon, mababa ang tiyansa niyang makapasok.

30. Nous avons décidé de nous marier cet été.

31. Tumango siya at nagsimula nang kumaen.

32. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

33. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang ligawan?

34. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

35. Pakilagay mo nga ang bulaklak sa mesa.

36. The dedication of mentors and role models can positively influence and shape the lives of others.

37. Mas matangkad ako kaysa sa kanya.

38. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

39. Maliit lang ang kusina ni Lola Oliva.

40. Hindi ko sinasang-ayunan ang kanilang ideya kaya ako ay tumututol.

41. Siguro ay may kotse ka na ngayon.

42. Ang taong mapagbigay, sa kapwa ay may kapatid.

43. Magalang na nangumusta si Ana sa kanyang mga magulang pagkatapos ng isang mahabang biyahe.

44. Magaganda ang resort sa pansol.

45. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

46. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

47. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

48. La paciencia es clave para alcanzar el éxito.

49. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

50. Nagtapos siya ng kolehiyo noong 1982.

Similar Words

popularize

Recent Searches

populariyonbritishjocelynrosahusocanadaresumenkapenagpancitkalayaancafeteriaguestspicssumarapyelotingseekhithalamanabstainingadvancedmagbungamayumingipaghandaumanouniquebilinglibagservicesumilingthemputiaddingbituinitemsentrymasayamagkasintahantanghaliginangkriskaperwisyokaraokebaketheirnabigkasnag-aaralnanghihinaauthorpdaahasdatitanggalinpaaumiiyakgumandapagkagustonapatinginproduciruniversityforcesheartbeatninumanbarkonaniniwalateacheripantalopexpenseskatamtamannagpapaigibadamagsalitavillagesiyudadtanongmakakabaliknag-aralmatamispinabulaantechnologybintanaleadingincomesiemprebunutanbumugainisinangcomputere,cupidmaligayaincludepreviouslypisonagbababaluzpropensoglobalbilljudicialimaginationganitodalawampuoperahanmakasilongipapainittugonsutilnagpapasasamagagandangmagnakawphilippinealsoilanbibigyanaeroplanes-allmagtakafysik,paospalaynabiawangnabuhaytumigiliniirognagyayanggamitinfuncionarmacadamiasubject,bagamatkanyalunastelephonegatolhelenamalawaknapakalusogiintayinangelabuhokshoppingawaayawpadabogstateferrercesliveigigiitbusiness,encompassesilangeuphoricreportlapitansemillasvehicleskaniyahalinglingmangingisdangpasaheika-50kargahanmagselostravelneroscreationmuchmainstreamsteerlastingcontinuespracticadokayopagdamimatangkadkakayanantransportbihasathirdsyncwaitcomputersberkeleyvancontrolapakanta-kantangkinagalitannabalitaanrenombreressourcernepoliticalhinagud-hagodunibersidadnakapagngangalitmaraminangangaralnakalipas