Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sumalakay nga ang mga tulisan.

2. At pagkauwiy humiga nang humiga at paulit-ulit na tumingin sa kawalan.

3. He is taking a walk in the park.

4. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

5. She studies hard for her exams.

6. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

7. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

8. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

9. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

10. Mamimili si Aling Marta.

11. Drømme kan være en kilde til kreativitet og innovation.

12. Gusto ng ina na matuto si Pinang ng mga gawaing bahay, ngunit laging ikinakatwiran ni Pinang na alam na niyang gawin ang mga itinuturo ng ina.

13. Mas mainit ang panahon kung walang hangin.

14. Ang maliit na mesa ang nasa kuwarto.

15. Umalis siya upang hanapin ang sandok na hinahanap.

16. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

17. Le jeu peut avoir des conséquences négatives sur la santé mentale et physique d'une personne, ainsi que sur ses relations et sa situation financière.

18. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

19. Ang mga kundiman ay bahagi ng ating kultura at nagpapaalala sa atin ng halaga ng pagmamahal at pag-ibig sa ating kapwa.

20. The charity organized a series of fundraising events, raising money for a good cause.

21. Nagulat si Mang Kandoy sapagkat ang kulay ng dugo ng tigre ay abo.

22. Kuripot daw ang mga intsik.

23. Sa may ilalim, nakuha niya ang kulay-lumot niyang kamiseta.

24. Ang nakita niya'y pangingimi.

25. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

26. Hugis katawan ng nakahigang babae ang bundok makiling.

27. Hindi pa rin siya umaalis sa kinauupuang balde.

28. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

29. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

30. Siya ay kilala sa kanyang magalang na pag-uugali kahit sa mga hindi niya kakilala.

31. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

32. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

33. Sinigang ang kinain ko sa restawran.

34. Sino-sino ang mga nagsibili ng mga libro?

35. Pasensya na, kailangan ko nang umalis.

36. Oo nga noh? Pero di bale, advance gift ng ninong. aniya.

37. Ang ganda naman ng bago mong cellphone.

38. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

39. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

40. Nationalism can have a positive impact on social and economic development.

41. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

42. Have they visited Paris before?

43. Umiinom si Andy ng vitamins kaya ang katawan nito ay bihirang magkasakit.

44. Ang bulaklak ay mabango at nakakapagbigay ng kasiyahan sa amoy.

45. She is learning a new language.

46. Sa pagtitipon ng mga lider ng relihiyon, ibinahagi nila ang kanilang mga mungkahi upang mapalakas ang pananampalataya ng mga miyembro.

47. Bahagya na niyang maulinigan ang ina.

48. The elephant in the room is that the company is losing money, and we need to come up with a solution.

49. The zoo houses a variety of animals, including lions, elephants, and giraffes.

50. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

Similar Words

popularize

Recent Searches

popularsetyembrenagpuntagagsoundginaganoonilocosbobobroadcastmalapadbarnessakinipanliniskadaratingmariofiaginangspentmabilisawa1000maglalaroinalokluisexpertataquesbeintebranchesbansaglobalbuwalhallspendingcryptocurrency:masdanartificialtrainingauthorferrerlayuninaidbulabulsainterpretingrolebrideatesutilpollutionhearmalakimahirapbinilingclockreffutureeffectsconsidergoingincreasedgradually2001ipongdarksecarseinspiredgabrielvehiclesredganoonnochepakaininnangingisaymilyongpunong-punomagalangtsaalaki-lakilegitimate,dedicationnasasalinanpa-dayagonalplatformkuyakitamakulitpagsagotreaderseveningroboticlumutangprutashangincineanyopalikuranventabinabapanimbangginagawamagkakaanakcornersukol-kaydispositivokirotraisetinuturopakibigayzamboangaexigenteinastamissionvivabossinimbitayeymatikmanmagazinesboksinggalitcompartenleemayabongfallfistsinformedlagingmamitasmejomagsisinemediantemakakawawapapagalitansasayawinpinakabatangpinakamagalingpinapakiramdamanmanggagalingmahahanayinferioressasagutinnahuhumalingsakristanpaumanhinisulatkatawangbuung-buomagbantayseguridaddisfrutartag-ulanawtoritadongfestivalesmagpalagopinag-aaralannakakarinignakapasokpermitekatutubohurtigeremauuporegulering,nailigtasinilistamasyadongpuntahannagtataecompanykirbyganapinbinitiwantinikmanmanakbotalinokonsyertogumigisingpinangaralancruzdalawangkumaennakabiladsidokusinaisinamarightsginalaganapvaledictorianimbesnandiyanwonderidiomasisipainmabutiisipanvelfungerendepagpasokmauntogdeletingsumingit