Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

2. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

3. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

4. Las redes sociales son una parte importante de nuestras vidas hoy en día.

5. Ang snob naman neto. Alam mo ba kung anong oras na?

6. Kunwa pa'y binangga mo ko, ano, ha? Magaling, magaling ang sistema ninyong iyan.

7. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

8. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

9. Ang mga opisyal ng barangay ay nag-organisa ng programa kung saan ang mga residente ay maaaring lumibot sa kalsada para sa pagsasanay sa kalusugan.

10. Los héroes están dispuestos a enfrentar los desafíos y luchar por lo que creen.

11. Portion control is important for maintaining a healthy diet.

12. The use of emphasis is influenced by cultural and social norms.

13. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

14. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

15. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

16. Bukas ay mamamanhikan na kami sa inyo.

17. Los Angeles, California, is the largest city on the West Coast of the United States.

18. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

19. Maraming mga anak-pawis ang hindi makatugon sa kanilang mga pangangailangan dahil sa kakulangan ng oportunidad.

20. She missed several days of work due to pneumonia and needed to rest at home.

21. The charitable organization provides free medical services to remote communities.

22. Bakit wala ka bang bestfriend?

23. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

24. Nagagandahan ako kay Anna.

25. Ilang oras na ang nakalipas ngunit hindi pa nauwi ang batang si Ana, nagpatulong na si Aling Rosa sa mga kapit-bahay na hanapin si Ana.

26. He used his credit to buy a new car but now struggles to make the monthly payments.

27. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

28. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

29. Nagtataka ako kung bakit hindi mo pa rin maipaliwanag sa akin kung ano ang totoong dahilan.

30. Ang mailap na pagkakataon ay kailangan hanapin sa kung saan-saan upang hindi ito masayang.

31. Mahal ko ang pusa ko dahil malambing siya.

32. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

33. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

34. Kahit ilang beses ko na siyang tawagin, tulala pa rin siya sa kanyang pagmumuni-muni.

35. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

36. Happy Chinese new year!

37. Isa sa nasa pagamutan na iyon si Bok

38. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

39. Traveling to a conflict zone is considered very risky.

40. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

41. "Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan" ay isang bukambibig na nagpapaalala na mahalaga ang pag-alala at pagpahalaga sa mga pinagmulan.

42. Minsan lang ako nag mahal ng ganito.

43. Nag-aral kami sa library kagabi.

44. Since wala na kaming naririnig medyo kumalma na ako.

45. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

46. Hinde na ko nag dalawang isip pang lapitan sila.

47. Saan itinatag ang La Liga Filipina?

48. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

49. Skolegang er en vigtig del af børns opvækst og udvikling.

50. The early bird catches the worm.

Similar Words

popularize

Recent Searches

popularideyaipagpalitpassionkumaripasitanongmagsaingkesolaranganmaputulankombinationkanyangkidkiranflamencocarriedgalitsasakayhunimakakakainkaninbroughtmabangoprogrammingayonumigtadmatandangnochetanawinjustchefkabiyaklending:tilaviolencestockspagkabatasapagkatpatutunguhannagpakunotwastenagpasamasumingitmatapangpasasalamatnaglahokaarawanyumabongsubalittalaganginspiredipinatawagcitizenskamalayanmamibwahahahahahanewspapersnakikitangpondomanuscriptsikrer,malilimutinseasonmarahilbangosilanmapuputiincreasesnapahintotahananitongpintuananybasketballmagkanomalamangkungipapainityatagarbansosipinatutupadsangkapmukhagiitpangitpunopagkakahiwamalihislalawigansang-ayonpotaenapalabaskapataganresultamaasimbagkus,justinsakitnakisakaybulaklakmagpapakabaitmunahayoplabing-siyamlalabhanmakasalanangmasayadalagangnag-usapalingonlinengitiadaptabilitybundoknunsusunduinbahay-bahaythirdkayacampfastfoodnagsisikaingusalimayakapaplicardalanovemberlumamangsasakyanpakibigyanprutastotoongsigurokasalnag-googlebigongpangulotamanagkantahanpresidenteilawmag-ibarelativelygurokahirapankaguluhanpagkamanghakinuhabulalasnapangitikatamtamanngunitipinaalammalakibituinaccesskambingestadosriyanulingtanghaliansumusulatpaboritongnalalabikasimayabangramdambaulnaiinitannag-iinomwarigabi-gabikenjilagimartadotanatutokkumakainmuypunong-kahoypaligsahanitstambayankatagangprogramming,obstacleskuliglignatinagdahilkaedadlangostainfusionesmaglalakadmaglakadfilipinaterminotuwingkapagpinsanambagayaw