Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

2. Nagtatrabaho ako sa Mimosa Family Home.

3. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

4. Nakatitig siya sa tatlo pa niyang kapatid.

5. Magsisine kami sa makalawa ng hapon.

6. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

7. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

8. Magdamag na bukas ang ilaw sa kwarto.

9. Gaano kalaki ang bahay ni Erap?

10. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

11. Maglalaro ako ng tennis. Ikaw?

12. Napatulala ako sa kanya. Di ko alam ang isasagot ko.

13. Leukemia is a type of cancer that affects the blood and bone marrow.

14. Pardon me, but I don't think we've been introduced. May I know your name?

15. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

16. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

17. La pintura al óleo es una técnica clásica que utiliza pigmentos mezclados con aceite.

18. Television is one of the many wonders of modern science and technology.

19. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

20. Tanging edukasyon lamang ang pag-asa nating mahihirap.

21. Papunta siya sa Davao bukas ng tanghali.

22. Many dogs enjoy going on walks and exploring new environments.

23. Ano ang ipinabalik mo sa waiter?

24. Ngunit lingid kay Roque, may namumuong lihim na pagkagusto sina Magda at Damaso sa isa't isa.

25. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

26. Napatunayan nilang lason ang mga bunga nang isang araw ay may napadpad na manlalakbay sa kanilang bayan.

27. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

28. Ang mommy ko ay masipag.

29. Sadyang naging matagumpay ang kanilang proyekto sa paaralan.

30. Ano ang ginagawa mo nang lumindol?

31. I am not teaching English today.

32. They may draft and introduce bills or resolutions to address specific concerns or promote change.

33. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

34. Sinabi umano ng saksi na nakita niya ang suspek sa lugar ng krimen.

35. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

36. Ipinagbabawal ang paglapastangan sa mga simbolo at sagrado ng mga kulto at relihiyon.

37. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

38. Nanginginig ito sa sobrang takot.

39. Oh ano na? Hindi ka na sumagot?

40. Nakatayo ang aking guro sa harapan ng silid-aralan upang ipakita ang kanyang mga visual aids.

41. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

42. Ayoko na pong maging pabigat sa kanila.

43. Nahantad ang mukha ni Ogor.

44. She has been running a marathon every year for a decade.

45. Oo. Tatawagan ka daw niya pag nandyan na siya.

46. Hindi dapat tayo gumamit ng marahas na wika sa mga pag-uusap.

47. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

48. Einstein was married twice and had three children.

49. Siniyasat ni Sangkalan at ng mga tao ang puno.

50. Better safe than sorry.

Similar Words

popularize

Recent Searches

populartiniklinglagnatsakyannakakatabastoretandangiilananibersaryopaparusahangovernorsnaglakadmenosunangmaglalakadlivemahahanayhurtigereasahanlucyguerreronginingisihantanawmahabapangulotaximarasiganisinumpatawasmokererapabenenaliwanagantungawclienteskingdomnatutulogkutodaabottakesbabaskyldesbathalaboxbigongshadesbestnagpaiyaknagtatampomasasarapnagsilapitbilibidkumustaadmiredpagsagothugislinesasakyanmagkaharapreservesjosesakristanoperahanprovidedrawoverviewsourceswriteincitamentermulti-billionbehaviormakawalascalelumusobsparkasignaturapinaladdoinguugud-ugodpinsansino-sinohangintulonglumangoywealthelectednagbabasamabalikfinishednaiwangilalimnakahugpasalamatanmabilistraveleyahuluflashdraft:editorpagimbayditosuchshareelectoralmagpapaikotlistahanallekontratabugtongconectanpesolumayowarichoicepageanthinigitwithoutspreadsteamshipsnightcornerslolonapatawagpotaenacenterdescargarnapakamisteryosobusiness:attorneypresleyhuertodeallinggongfotosmassachusettssocialesletterobra-maestranaiilanginjuryescuelasfilmgayunmankaloobangnagpasamaasinbutimedicinepangungutyatumulaksementotinikmanfederalismminutematagumpaykilongnamulatbangkoeksempelhinamaknationalbabesnatatawanaka-smirkhimayindeliciosabagamathanapinkelanpagpapasanbinibiyayaanakmanggumuhitkalupisalbaheconvertidasanghelinvitationproducts:napaiyakkinantaimpactperseverance,barongpakpakuulaminnilapambatangmasaktanmakikiraanyorklawsnagpapasasapalasyokasamaangkanginalalakingbagongnananaghili