Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

2. ¿Cuánto cuesta esto?

3. Las personas pobres son más vulnerables a la violencia y la delincuencia.

4. They have lived in this city for five years.

5. Maya-maya, muling naupo at dumukot ng isang lapis at isang maliit na kuwaderno sa kanyang bulsa.

6. Kape ang iniinom ni Armael sa umaga.

7. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

8. Butterfly, baby, well you got it all

9. Laughter is the best medicine.

10. Oo nga, yung last time eh nung birthday ko pa. ani Genna.

11. Paki-translate ito sa English.

12. El discurso del político está llamando la atención de los votantes.

13. I am absolutely grateful for all the support I received.

14. La tos puede ser un síntoma de afecciones menos comunes, como la sarcoidosis y la fibrosis pulmonar.

15. Marahil ay hindi mo pa nakikita ang bagong pelikulang ito kaya't dapat mo itong abangan.

16. Sa aming pagsasaliksik, nagkaroon kami ng maraming mungkahi upang mapabuti ang aming eksperimento.

17. At have en klar samvittighed kan hjælpe os med at træffe de rigtige beslutninger i pressede situationer.

18. The rise of digital currencies and payment systems is changing the way people use and think about money.

19. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

20. Maaaring balang araw ay magkaroon din siya ng mamanuganging may sinasabi rin naman

21. El graffiti en la pared está llamando la atención de la policía.

22. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

23. Nanggaling ako sa loob ng sinehan at napakadilim ng paligid dahil sa matinding liwanag sa loob.

24.

25. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

26. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

27. Yakapin mo ako, habang atin ang gabi.

28. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

29. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

30. Nabasa mo ba ang email ko sayo?

31. Walang matigas na tinapay sa gutom na tao.

32. If you're trying to get me to change my mind, you're barking up the wrong tree.

33. May mga taong nagkakaroon ng mga panaginip tuwing natutulog sila.

34. Sa pamamagitan ng bayanihan, nagkaroon kami ng pag-aayos ng mga kalsada sa aming lugar.

35. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

36. She burned bridges with her friends by spreading gossip about them.

37. Women have made significant strides in breaking through glass ceilings in various industries and professions.

38. Before a performance, actors often say "break a leg" to each other for good luck.

39. Sadyang mahirap ang pag-aaral ng calculus, ngunit sa tulong ng tamang libro, maari itong maging mas madali.

40. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

41. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

42. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

43. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

44. No hay que buscarle cinco patas al gato.

45. Gagawa ako ng tsaa pagkatapos kong kumain.

46. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

47. Mahusay mag drawing si John.

48. Ang hindi pagtulog ng sapat na oras ay maaaring magdulot ng pagkapagod at kakulangan sa enerhiya sa araw-araw na buhay.

49. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

50. Ang tagumpay ng ating bayan sa larangan ng sports ay ikinagagalak ng buong bansa.

Similar Words

popularize

Recent Searches

ilocospopularestarsinapakkantokablanbotantebilaolegislationailmentsmahahabalarobalitanakikitasiguromagulangscientificjokedalandanfireworksnagbungaseestaple1980sellmagpuntapasanlatercommunicationschadpingganscientistabenetheynitongintopollutionmainitstatusiosnilutomacadamiaofferwealthniyantiyasafestoplightipihitdarkhiminilingpeteritinuringcleancertainrangecreatecomunicarsestyrermagingcasesestablishednicepuntabusilaklingidmestskillskumalmanapaunomahusaydahanmagdaraosmaghilamosnoongmarahilcomeproperlynagsuotpaanotumikimyourlayout,bedsnatintrainingwhethermakapangyarihangnakapangasawananghihinamadnagtitiisnagtatrabaholaki-lakikategori,sasayawinpagpapasankainanpagkakamalinagpaiyakhinipan-hipanmanlalakbaysaranggolamakikipag-duetopospororenombrepahahanapmaliksipanghihiyangdumagundongmakatarungangsakristannakapaligidinferioresmahiwagangdapit-haponcuandoleadersmalapalasyonakapasakasintahanambisyosangihahatidtinutopnagmadalingmakikikainnakatulogkaharianinuulcerpagamutansundalolabinsiyamarbularyomagkasamakisslumakaspangungusapkalabawtemparaturatindahangagamitpawispakilagaynilaosnakauslingkamaliannasilawiligtaspwestobilibidakopagtatakagiyerakuwentolumutangmaanghangpeksmantahananpagsagotkanlurantaglagassalbahengmarmainglungsodtelecomunicacionesmaghihintaynagbagonanangispakakasalandiyaryoprincipalesmangyaripakinabanganharapanipinangangaklaganapabigaelnanigasdyosaresearch,commercialctricasunosrimaskababalaghangagostoisipanumibigbibilhinanunghuertoahhhhpresencepalitancityydelserkakayanangkaybilisaffiliate