Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang arte. bulong ko sa may batok niya.

2. I know we're behind schedule, but let's not cut corners on safety.

3. Wala naman sa palagay ko.

4. Naghahanap ako ng mapa ng bansa para sa aking proyektong pang-geography.

5. Medyo napalakas ang pag kakauntog nya sa pader.

6. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

7. Mapapansin kaya sa dami ng 'yong ginagawa

8. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

9. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

10. Masarap ang pagkakaluto mo ng kare-kare.

11. The students admired their teacher's passion for teaching and learning.

12. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

13. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

14. Higit kong daramdamin kung ako na itong nagawan ng di mabuti ay sa kanya pa manggagaling ang huling salita.

15. Palibhasa ay karaniwan nang nakakamit ang kanyang mga layunin dahil sa kanyang determinasyon at tiyaga.

16. En invierno, las personas disfrutan de bebidas calientes como el chocolate caliente y el té.

17. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

18. Ang poot ay parang apoy na unti-unting umaalab sa aking loob.

19. The teacher does not tolerate cheating.

20. Television is one of the many wonders of modern science and technology.

21. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

22. Ngunit may isang hayop ang hindi niya malaman kung saan siya papanig.

23. Ang agila ang pambansang ibon ng Pilipinas.

24. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

25. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

26. Sang-ayon ako na kailangan nating magkaroon ng sapat na pondo para sa pagpapaunlad ng ating mga komunidad.

27. Sa kalikasan, mahalaga ang mga punong-kahoy dahil ito ang nagpapakain sa iba't ibang uri ng hayop at insekto.

28. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

29. Nasa Pilipinas na si Raymond ngayon.

30. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

31. Masakit man aminin, hindi maiiwasan na mag-inis tayo sa mga taong nakapaligid sa atin.

32. Tumalikod siya bigla saka pumasok sa kwarto niya.

33. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

34. Kinuha ko yung CP niya sa bedside table.

35. Ang saya saya niya ngayon, diba?

36. A lot of money was donated to the charity, making a significant impact.

37. Mabuti pa nga Babe, bugbugin mo na yan. pagbibiro nila.

38. A quien madruga, Dios le ayuda. - The early bird catches the worm.

39. The elderly are at a higher risk of developing pneumonia.

40. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

41. When he nothing shines upon

42. They analyzed web traffic patterns to improve the site's user experience.

43. Technology has also played a vital role in the field of education

44. Lumakad sa kalye ang mga kabataan nang limahan.

45. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

46. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

47. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

48. Ano ang isinulat ninyo sa card?

49. My name's Eya. Nice to meet you.

50. Nagtaas na nang pamasahe ang bus.

Similar Words

popularize

Recent Searches

ninongmalihispopularninayamangiyeragoddumalawpagluluksaginugunitanagpapaigibmakapaibabawkategori,pinagsikapannakaliliyongmurang-muranag-aalanganpagpapatubohugismakatarungangdadalawinalbularyoaanhinkinauupuantatlumpungpinapasayapinagpatuloymumurasasayawinagam-agampagkahapoarbejdsstyrkemabihisantatagalforskel,makikitulogpresidentemananakawminu-minutonagcurvepronounpagpiliihahatidkumikiloscondomaibibigaypanindanapatigilmakapalnagsinenagsuotengkantadangkamiaspagamutanlondontangeksnaglahomangahasbangkangpagdiriwangiyamotpaanonagbagojosiemarketing:tumatawadkaliwamasaganangginawaranpabulonghaponandreakanayanggroceryvegasnangingisaygusalimisyunerongmaluwagaayusinpaakyatbintanapantalongnawalainvestingbulongaaisshkaragatancampaignshinampasgasmencoughingeleksyonsumasaliwlalimbantulotlagaslasbunutanisubodraybersuelofacebookcebuboboproperlytryghedbipolarbabaebarnestime,hangaringaccedereventssineambagmalikotasiaticpresleycolornaglabananrestawranmatayogcarolnatagalancubicleexpertiseburmaisipanpupuntanalasingsumalamapakalinotfigurespedemalapitjamesexperiencesbinabaanreservedhanmamitemperaturalightstrainingdownsamarestoverbringkiloexpectationsidea:makilingbulsaipasokauditbest1973itimumagawandroidincludeyeahwaitbehaviorwhethertechnologicalandreseparationnotebookbroadcastinghapdibroadcastsapollotinatawagkisapmatayatanalalagassambitsuzettematagalkargangnapakotelefongoalspecialdesisyonanfansrinmbricostahanancharitablekasalukuyantelebisyonpaglalaittungkodcultivamaramingnamumuo