Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Mag-iikasiyam na nang dumating siya sa pamilihan.

2.

3. Isinawak niya ang kamay, pinagkiskis ang mga palad at pagkaraa'y naghilamos.

4. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

5. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

6. Nang matuklasan ng binatilyong apo na siya ay isang pangit na hayop na, kumarimot siya patakas sa baranggay.

7. Kung hei fat choi!

8. Uncertainty about the outcome of the election has caused tension in the community.

9. Ailments can be a source of stress and emotional distress for individuals and their families.

10. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

11. Dogs can develop strong bonds with their owners and become an important part of the family.

12. Ang Ibong Adarna ay isang sikat na kwento sa panitikang Filipino.

13. Magkamali ka, hindi makakatakas sa kanilang mga mata.

14. La realidad nos enseña lecciones importantes.

15. Gusto mo ba ng mainit o malamig na kape?

16. Kapag bukas palad ka sa iyong mga pangarap, mas madali itong makamit dahil hindi ka nagtatago sa mga taong pwedeng magbigay ng tulong.

17. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

18. In this industry, singers who can't write their own songs are a dime a dozen.

19. La amistad entre ellos se fortaleció después de pasar por una experiencia difícil.

20. Saya suka musik. - I like music.

21. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

22. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

23. Naglaro sa palaruan ang mga bata nang limahan.

24. As a lender, you earn interest on the loans you make

25. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

26. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

27. I prefer to arrive early to job interviews because the early bird gets the worm.

28. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

29. Inflation bezieht sich auf die allgemeine Erhöhung der Preise für Waren und Dienstleistungen.

30. After finishing the marathon, the runner was euphoric with their achievement.

31. Kulay pula ang libro ni Juan.

32. Pag-akyat sa pinakatuktok ng bundok.

33. Napuyat ako kagabi dahil sa panonood ng k-drama.

34. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

35. Los padres pueden elegir compartir el momento del nacimiento con familiares y amigos cercanos, o mantenerlo privado y personal.

36. Umalis siya upang hanapin ang sandok na hinahanap.

37. Binalita ng magkasintahan ang kanilang kasal at ang nakatakdang araw ng pamamamanhikan.

38. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

39. Sino sa mga kaibigan mo ang matulungin?

40. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

41. Sinikap niyang kumbinsihin ang mga katutubo upang maging Katoliko.

42. Drømme kan være en kilde til inspiration og kreativitet.

43. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

44. Napakahaba ng pila para sa mga kumukuha ng ayuda.

45. Kapag bukas palad ka, mas maraming taong magmamahal at magtitiwala sa iyo.

46. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

47. Ang marahas na paggamit ng teknolohiya, tulad ng cyberbullying, ay dapat itigil at parusahan.

48. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

49. Pinabulaanang muli ito ni Paniki.

50. Napangiti ako bigla. Yun lang ba yung problema niya?

Similar Words

popularize

Recent Searches

lipadpaskongpopularuntimelytoyabanganenergipagputikuyainimbitatibiglumakiiniwanubodamerikablazingcalciumiguhitflavioindustrybeginningstwitchcinechoiapoypumatolisipdagabansatingcardspeechescivilizationclasesbroadcastkabibikablanreadersjoshmaluwanggatheringnotpaglapastanganinumincolourbardetbinabaanellamacadamiabranchesguestsriskrobotic18thmeetmasokbalingconmalakingelectedventaipongpotentialformvisipapainitlikeuminompowerstargetpromotingattackprogramauloclockulingdifferentgitarayeahdulorefspreadcompleteryanworkingmakakakaenbagaypinapanoodkumikilosnalamanlastingbantulotmakapalpinunitpisinagyayangunti-untialmacenaramericaninfluencesmaulitmaranasanmamisumaladaratingwealthnagtatanongjamesexplaintsakabaranggaytulalalimitseriousrebounddaramdaminsciencelosspahahanapnewsnagplaykamakailannglalabasocietypulongculpritkombinationramdamtransmitidasindividualwalismaghanapumikotmaglalakadkawili-wiliavailabletechnologicalnapakabagalfilipinoatenabagalannagmamadalimalezainaamininsektongfitnesskingdomumakbaywatawatpaki-ulitabundantelalabasdyipnikapintasangpinauwilumipadmarurumiminamasdanmaynilakutodkaraniwangtagalogsemillasshopeemawalasasamahancommercialharisumamaipagamotroquemediumemphasisglobalpinagawabanyostructurenagdaankenditantananhellocapitalgripoinventadopagkatkagyatpinagmamalakidapit-haponnakaangatnalalaglagnakatuwaangerhvervslivetnagbiyayanakaririmarimhinawakanjuegospaghaliknanunuksopatakbo