Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

2. Remember that the most important thing is to get your ideas and message out to the world

3. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

4. They have donated to charity.

5. Napakagaling nyang mag drowing.

6. Maingat na nangampanya ang mga kandidato ayon na rin sa alituntunin ng IATF.

7. Oh.. hindi ko alam ang sasabihin ko.

8. Bagamat sa Limasawa, Leyte nagdaos ng unang misa, may isang paring Kastilang nagngangalang Padre Novelles ang nakarating sa lalawigan ng Nueva Ecija.

9. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

10. The politician made a series of speeches, outlining her plans for improving healthcare.

11. The king's royal palace is his residence and often serves as the seat of government.

12. Gelai, siya si Tito Maico. sabi ko sabay turo kay Maico.

13. She's always creating drama over nothing - it's just a storm in a teacup.

14. Hindi ako usually ganto, pero sana pwede ba kita makilala?

15. Wala namang ibang tao pedeng makausap eh.

16. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

17. Ang nakita niya'y pangingimi.

18. Bumili ako ng blusa sa Liberty Mall

19. Omelettes can be made using egg whites only for a healthier, lower-fat option.

20. Puwede paki-ulit ang sinabi mo?

21. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

22. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

23. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

24. I usually like to tell a joke to break the ice at the beginning of a presentation.

25. ¿En qué trabajas?

26. Hello. Ito po ba ang Philippine Bank?

27. La agricultura es una actividad fundamental en muchas regiones del mundo.

28. The feeling of finishing a challenging book can be euphoric and satisfying.

29. Si Jeny ay bigong manalo bilang presidente ng kanilang paaralan.

30. Laganap ang fake news sa internet.

31. Napatingin ako sa orasan. 12 na ng madaling araw.

32. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

33. Masyadong maaga ang alis ng bus.

34. Ano ang gagawin mo sa Linggo?

35. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

36. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

37. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

38. Umihip ang malamig na hangin, waring may paparating na masamang balita.

39. Gusto po ba ninyong lumipat sa ibang kuwarto?

40. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

41. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

42. Anong wala! pasinghal na sabi ni Aling Marta

43. Ang mga medical technologist nagsisilbi upang magbigay ng tumpak na resulta sa mga laboratory tests.

44. Walang ka kwenta-kwenta ang palabas sa telebisyon.

45. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

46. Ang mga pangarap natin ay nagtutulak sa atin upang magkaroon ng mga positibong pagbabago sa buhay.

47. Después de la cena, nos sentamos a conversar en el jardín.

48. The park has a variety of trails, suitable for different levels of hikers.

49. Si Aling Juana ang tagalaba ng pamilya.

50. Nahulog ang saranggola sa puno ng mangga.

Similar Words

popularize

Recent Searches

popularmalihisnahigaparurusahansusisumisilipwatercanadakainabrilburmabalancesmapaibabawganaoperahangranadatshirtpakelampakainbosscongresscollectionsabalailogconsistbinigayaccederbuwallarrytenprobablementetherapybipolarstarcomienzannagbungaoverallplatformskilolcdareasbubongiosdoneipipilitgameinalokjodielihimwatchpasangoddontknowsaudio-visuallyipinikitreservedcoatsuelointeligentesentermerefacultyoffentligtelevisedendfurtherinternacionalcovidrepublicprutasiintayinkaawa-awangnakabawimadalingnapakaposts,laptopbilhinpaki-translateadditionmanilahimutoknatanonghehekalabanpumikitnapawinagwalisika-50pinipilitlever,makilalatarangkahanfonostransmitsadangwariwerekatandaanklasrumdahanbuenachoicepasalamatanbinigyangnitongcryptocurrencyboksingbasahanpinalutolegendsdalandanmemorymasdanwithouttableberkeleycontrolainaapivanactivityaplicarstatingbathalapoliticalmakapaibabawdistansyanamumulaklakmagsasalitakamimakalaglag-pantynananalomagpaliwanagnagpaiyakkinagalitanmakakawawasong-writingrenombrehinagud-hagodambisyosangpaghaharutansagasaannagbantaynabighaniuusapanpaumanhinpinapasayapartymahawaanbahalanakahugnaglokohayaangpahirampagkainismahiyalumuwaspangungusapmaliwanagsementeryoamazonmasakitkatutubopartspasyentemagpahabamakauwiyumabangna-fundtungokaratulangngitimabagalika-12taosenglishkapitbahaymasasabialletherapeuticsshadesmatangkadlaganapbibigyanaustraliakauntinagniningningmakisuyomagsaingtawanilapitantondobulongmabutiaregladonatitiraturonligawannakayuko