Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

2. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

3. Patunayan mo na hindi ka magiging perwisyo sa kanila.

4. Humahaba rin ang kaniyang buhok.

5. Pull yourself together and focus on the task at hand.

6. Binentahan ni Mang Jose ng karne si Katie.

7. Limitations can be viewed as opportunities for growth and personal development.

8. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

9. Mahal niya si Steve kahit na sumpungin ito.

10. The company's financial statement showed an increase in acquired assets.

11. Isang araw nagkasakit si Aling Rosa.

12. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

13. Anong award ang pinanalunan ni Peter?

14. Si Andres Bonifacio ay isang magiting na bayani.

15. Anong lugar ang pinangyarihan ng insidente?

16. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

17. Mommy. ani Maico habang humihingal pa.

18. Dahil ika-50 anibersaryo nila.

19. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

20. The height of the basket and the court size varies depending on the age and skill level of the players.

21. Makakarinig ka ng halinghing sa gym, lalo na kapag may nagta-training ng cardio.

22. Mag-aaral ako ngayon, datapwat sa hapon ay pupunta ako sa doktor.

23. Ewan ko apelyido pero basta Memo, kilala ka kasi nya eh.

24. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

25. Marunong nang maglinis at magtago ang mga taong marurumi.

26. Le chien est très mignon.

27. La seguridad y el bienestar de los agricultores y sus familias son importantes para garantizar un futuro sostenible para la agricultura.

28. Oy saan ka pupunta?! Bayad ka na!

29. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

30. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

31. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

32. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

33. Nilimas ang kanilang kabuhayan at sapilitang dinala sa tabing dagat ang kadalagahang napili.

34. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

35. Supreme Court, is responsible for interpreting laws

36. Mas magaling siya kaysa sa kanya.

37. Lumakad sa kalye ang mga kabataan nang limahan.

38. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

39. Ang bilis naman ng oras!

40. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

41. Gusto ko dumating doon ng umaga.

42. Ok ka na ba? tumango si Athena, Mabuti naman..

43. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

44. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

45. Halos maghalinghing na siya sa sobrang pagod.

46. Está claro que la situación ha cambiado drásticamente.

47. Hiramin mo ang aking payong dahil umuulan ng malakas.

48. All these years, I have been creating memories that will last a lifetime.

49. Nagsisikain ang mga bata ng tinapay.

50. Ang mabuting anak, nagpapakilala sa magulang.

Similar Words

popularize

Recent Searches

hetopopularcapacidadumalissabogfe-facebookshinesnoondagateffektivattentionmagsaingfiverrhehedespuesmournedbotonunoxixnoblelumulusobpatilifesiga00amkisapmatanakakainasopicspalaisipanbanlagpetsabeingbadforceslabingkingdomnakapamintanaihandakinatatakutannagpagupitkilobigyanmasaganangmaskbilugangeducativasmatabastagesofaginhawabakaculturatinataluntonalaymagkabilangpakelameropagkakapagsalitapagkainghapunanmeans2001maliniswaysnaguguluhanglegendaryjohnnakakatandaduribotetodayearnsumusunoabitrafficlamesabataysukatlawsumingitaccederbroadcastkabibiiginawadkinagagalaktaga-nayonpaglalayagpagka-maktolkawili-wilinakaakmatuwapagtatanongpagkaimpaktonagsunuranmagbabagsikhinawakannapaiyaknakaririmariminilalabasmonsignornakalilipasnagbiyayahila-agawanmorningmakatulogyoutube,nalakimanatilitangekspamilihanpagpanhikkanikanilangnakabawimakuhangpagkalitopaglisanambapagtatakamaasahanvaccinesharapannapakabilisnagsmileprimerosnaiisipmagtigilumiimikpinangalanangartisttumalimpinipilitlimasawakailanmansakalingmantikaoperativospinapakinggansumasayawemocionesnglalabacardiganumangatnabigyanpalasyosumasambamatayognagitlananigaslaganapgusaliunangpaakyatmanalokaraokeginabiglaanipinambilitinikmanrewardingtiemposmaynilakumainkayonewspapersnapakopalapagkinasinagabimatangumpayganyankapalkaniyajolibeenilayuanmatulunginlettercommunicationskriskabaketsacrificehoymalapitankasuutanbagalnatulogbestidafriendenergynasanapagodlarangangurosimuleringeritinatagpasigawanywheremalumbaykumukulomembers