Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. She studies hard for her exams.

2. Oo, bestfriend ko. May angal ka?

3. Pneumonia can be life-threatening if not treated promptly.

4. The sports center offers a variety of activities, from swimming to tennis.

5. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

6. Many people think they can write a book, but good writers are not a dime a dozen.

7. Ohne Fleiß kein Preis.

8. Di Indonesia, bayi yang baru lahir biasanya diberi nama dengan penuh makna dan arti.

9. Sa malamig ngunit maliwanag nang sikat ng araw, nakikita na niya ang langkay ng mga agwador.

10. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

11. Don't underestimate someone because of their background - you can't judge a book by its cover.

12. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

13. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

14. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

15. Makikita ko ang mga kapatid ko sa pasko.

16. En sund samvittighed kan hjælpe os med at tage ansvar for vores liv og handlinger.

17. Nasa Ilocos si Tess sa Disyembre.

18. Sino ang nagtitinda ng prutas?

19. Apa yang bisa saya bantu? - How can I help you?

20. Si Mabini ay naglingkod bilang siyang "Brains of the Revolution" noong panahon ng himagsikan.

21. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

22. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

23. Pangako ng prinsipe kay Mariang maganda.

24. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

25. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

26. Ang taong maramot ay madalas hindi sinasamahan ng iba.

27. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

28. Dogs can provide a sense of security and protection to their owners.

29. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

30. Da Vinci fue un artista renacentista muy importante.

31. If you think she'll forgive you, you're barking up the wrong tree.

32. Marami silang pananim.

33. Pumasok po sa restawran ang tatlong lalaki.

34. Alles hat ein Ende, nur die Wurst hat zwei.

35. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

36. Nagsayaw sa entablado ang mga mag-aaral nang limahan.

37. Ok. Free ka ba after work? Favor lang sana please.

38. Air tenang menghanyutkan.

39. Ang pamamaraan ng kasal ay nag-iiba sa iba't ibang kultura at relihiyon.

40. Ang aking teacher ay hindi muna nagturo ngayong araw.

41. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

42. Kumain ako ng macadamia nuts.

43. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

44. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

45. L'accès à des soins de santé de qualité peut avoir un impact important sur la santé et le bien-être des populations.

46. Nagpaluto ako ng adobo sa nanay ko.

47. Hindi ko alam ang sagot, pero sa ganang iyo, ano ang dapat gawin sa sitwasyong ito?

48. Isang magdadapit-hapon, habang nagpapasasa si Kablan sa marangyang hapunan, isang uugud-ugod na matanda ang kumatok sa kanyang bahay.

49. Saan ka kumuha ng ipinamili mo niyan, Nanay?

50. Ang mga kundiman ay nagpapahayag ng pighati at lungkot ng mga taong nagmamahalan.

Similar Words

popularize

Recent Searches

popularpasigawagadganoonganatradesiponinantaysumayailogitinaasrabemagulangmadamiitonggearbecomebinawi1876cupidpigingsnobloanssinapakpinagpatuloyabenepasyanatingalaresearch:bugtongaalisprovideuriplayedeasieroncedaanpookhinahaplospresshealthieripipilitplaysmeretuwidpalayannilutoinuminnagingcommunicationbumabayongallkinuskospasswordsiyentostumawaheianjositawitimsingerdaigdigkundimancigarettebundokconectanikinatuwagenerationseducationalkasalananbroadcastbansangbitawaneasyboysiraipapahingaseenkaninumannag-replyumagaexpertisenatigilannamumukod-tangiibabawmagta-trabahopinagalitantinitirhanlibrodelachecksinilingmaingaykaramiuminomlimitfredbowsimulapaboritongtiyasafenahintakutanamountmakingpackagingclassmatesandwichkamatiswaysalmusalferrerpakainmaunawaannaiinggittinigilalinroughbetagoogleinterviewingclientemagpakasalpasinghaleditorlandeconditionadaptabilityincreasesnyebestidodinadaananblusangyonpongpagkalitopinilingano-anoipinagdiriwangtinataluntonpinigilanbahay-bahaystageobstaclescallerhanginapatniligawankahuluganbiyastinangkakamotebagamamapapametodenag-asaranlalakingtatawaganinteligentesmarunongjoealikabukinnothingabsbookfoundexpensesminamahaltumingalakinakaliglignakitawhichmagkikitatelanglakadmagbalikcuentaneffektivmakikitulogtitohouseholdsmeriendapaki-drawingawaremayamayakargahanprogramsenglishpitakapumikitrevolutionerettindapagsalakaymatagpuanaspirationomfattendeboyfriendpananakitbien