Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

2. Sayangnya, acara itu sudah berakhir. (Unfortunately, the event has ended.)

3. Ang mga dentista ay may mga kagamitan na ginagamit upang masiguro na malinis at malusog ang mga ngipin.

4. The beauty store has a variety of skincare products, from cleansers to moisturizers.

5. Nous allons faire une promenade dans le parc cet après-midi.

6. She is drawing a picture.

7. Ang mailap na mga bagay ay kadalasang may halaga dahil sa kanilang kakaibang katangian.

8. Gunung Bromo di Jawa Timur adalah tempat wisata populer untuk melihat matahari terbit di atas gunung berapi yang aktif.

9. A lot of time and effort went into planning the party.

10. Hindi naman yan iniisip eh! Pinapakiramdaman!

11. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

12. **You've got one text message**

13. Sakay na! Saan ka pa pupunta?!!

14. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

15. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

16. Limitations can be challenging, but they can also inspire creativity and innovation.

17. Sa kasawiang-palad ay tinamaan ang magkakapatid at agaw-buhay na bumagsak sa tubig.

18. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

19. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

20. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

21. Kailangang mabagal at marahan ang apoy.

22. Min erfaring inden for dette område har været meget givende.

23. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

24. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

25. At samantalang nakadapa, unti-unting nabuo sa walang malamang sulingan niyang mga mata ang mga paang alikabukin.

26. Anung email address mo?

27. Susunduin ni Nena si Maria sa school.

28. Los padres sienten un inmenso amor y conexión instantánea con su bebé desde el momento del nacimiento.

29. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

30. Nag-iingat siya na hindi humalinghing nang malakas dahil baka mahalata ng kanyang kalaban.

31. Kumaripas si Lito nang makita niyang naglalakad na papalapit ang guro niya.

32. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

33. Hindi naman halatang type mo yan noh?

34. Gaano katagal ho kung sasakay ako ng dyipni?

35. Tiyak na may isda kang mahuhuli! Sige, layas! Layas! pinagtulakan ni Kablan ang kaawa-awang matanda na napasubsob sa tarangkahan ng malaking bahay.

36. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

37. Si Dr. John ay isang doktor sa kanilang baryo.

38. Inakalang wala nang natirang pagkain, pero may tinapay pa pala sa mesa.

39. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

40. Magaling maglaro ng chess si Joseph.

41. Matagal ko na syang kaibigan sa Facebook.

42. Pa-dayagonal ang pagkakahiwa ko ng hotdog.

43. The pretty lady in the movie stole the protagonist's heart.

44. Muli niyang tiningnan ang nakabulagtang si Ogor.

45. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

46. Nationalism can also lead to a sense of resentment and hostility towards outsiders.

47. Nagngingit-ngit ang bata.

48. Mahalaga na magkaroon tayo ng mga pangarap upang maabot natin ang ating mga layunin.

49. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

50. El agua potable es fundamental para mantenernos hidratados y saludables.

Similar Words

popularize

Recent Searches

popularlipatsandalischeduleriyanadobopaghingihehenagbulongusaparagraphsinatupagabrilmalakingbilingabundanteservicesauthorasignaturataga-nayonpananglawestadosinuunahangiverlaruinendvidereengkantadabusiness,tuvopalibhasafresconangpisoparatingmakahingibumahapapanhiknanghahapdinakalagayiwinasiwastumatawadelepantetotoonginilabasadoptedmagtakaagilasumalakaymakisuyodiversidadairplanessunud-sunodhanginmagtanimmagigitingiconicfloorsumabogpakelamjerrypagkasubasobnalalabicivilizationjingjinglayout,pooknucleargeologi,baranggaynagpepeketinulak-tulakkumakalansingplantasitinatapatkilayproduceamendmentsdyosaiginawadstoibinalitangkwebamangingisdatomarfind4thcolouruloitinuringnangapatdanpakiramdamputinginlovepagkagisingvitaminlalakematangkadtsuperpasasaanbayanipesoskumbentomabaithetoassociationfamenapatingalaipinikitsoonedit:ilingmamimisslumuwaskomunikasyonbarung-baronggratificante,pagsasalitagumagalaw-galawpapagalitannakapagsabinakakasamafilmsalamangkeronagmamaktollumalangoyvideos,nalulungkotmagtatagaltinangkahumiwalaymaglalaroeconomylabing-siyamkatawangnagkasunogpagkuwanagdaboglumilipaddiretsahangtumingalanapapahintotaglagasdagatcaracterizamaasahaninatakecarmenentertainmentincidenceendbevareelitevampireslackimagingatensyongnagsisigawnaghandaoncereviewersbumalingparaisomagtataasforskel,tinungoforcespangalannakaakyathistoriaisubopasensyapanosanganakihalubilovednagkalapitelectpumapasokpinapagulonguniversalmatagpuanmagkasamangleksiyoncultureshagdananpapalapitlumapadbihirangkundimanmaibaliksyamalinisbotedragonaddnangyariaplicacionesbaboyginugunita