Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Marahil ay hindi niya naaalala ang pangalan mo kaya't dapat mo siyang i-pakilala.

2. Inflation kann auch durch politische Instabilität verursacht werden.

3. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao.

4. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

5. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

6. Nagsisilbi siya bilang volunteer upang magbigay ng tulong sa mga nangangailangan.

7. Tsuper na rin ang mananagot niyan.

8. The sun sets in the evening.

9. El parto es un proceso natural y hermoso.

10. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

11. Le musée d'Orsay est un incontournable pour les amateurs d'art.

12. Bersatu kita teguh, bercerai kita runtuh.

13. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

14. Maaari po bang makahingi ng sobra sa hapunan ninyo?

15. Offering forgiveness doesn't mean we have to continue a relationship with someone who has repeatedly hurt us; setting boundaries is important for self-care.

16. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

17. They are hiking in the mountains.

18. Sweetness is an important factor in the culinary arts and food industry.

19. ¿Cómo te va?

20. Hinawakan ko yung tiyan ko, Konting tiis na lang..

21. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

22. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

23. Lumampas ka sa dalawang stoplight.

24. Ipagtimpla mo ng kape ang bisita.

25. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

26. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

27. Nasa kumbento si Father Oscar.

28. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

29. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

30. Sa daan pa lamang, bago siya pumasok ng tarangkahan, ay natatanaw na niya ang kanyang anak na dalaga na nakapamintana sa kanilang barung-barong.

31. Dahil sa kahirapan natuto siyang magnakaw at mandukot

32. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

33. Biglang bumangon ang hari at hinugot ang espada.

34. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

35. Makikita mo, maganda talaga ang lugar.

36. Transkønnede børn og unge skal have adgang til støtte og ressourcer til at udforske deres kønsidentitet i en tryg og støttende miljø.

37. Hindi dapat mawala ang kalayaan sa pagpili ng ating sariling relihiyon at pananampalataya.

38. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

39. O sige, ilan pusa nyo sa bahay?

40. Di mana bumi dipijak, di situ langit dijunjung.

41. Dapat nating igalang ang kababawan ng bawat tao dahil hindi natin alam ang kanilang pinagdadaanan.

42. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

43. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

44. Si Mabini ay isa sa mga pinakamatatalinong lider sa panahon ng himagsikan sa Pilipinas.

45. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

46. A dedicated student is willing to put in the extra hours of studying to excel academically.

47. Madalas na naglulusak sa dumi ang mga bakuran.

48. Natutuwa ako sa magandang balita.

49. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

50. Binuksan niya ang tarangkahan nang tahimik upang hindi magising ang mga bata.

Similar Words

popularize

Recent Searches

butterflymasasabistonehampopularnegrosna-fundpesoleytepnilitjingjinghinukaynagc-cravebironamasyalbulsahuwebeskaugnayanengkantadamayobinigaysupilinbiliotrofriesidiomatumalonpagkakatuwaandaigdigmadalingfrao-onlinesunud-sunuranmaatimpulangpasswordabonopagpapakilalapinunitkumakaininspirevidtstrakttog,electmakauuwiultimatelylakadnananaginipkumalmanananaghilinagtakakongbiggestbasahinbasahanlackorugare-reviewmagkakagustopaslitalapaappumuntataletomorrowkinalakihankumikilosnagmungkahibereticaketubigpayapangpolosong-writingbumubulainaabutanmalamangkayomagdalatinahakpapayaresignationnitostaplediyosikinamataysalesngumitimayamankasayawgamithalakhakmakikinigparticipatingsino-sinooperatenotebookgymngunitaayusinwritepokerdesarrollarongatheringipaliwanaglihimmumuracaraballokapangyarihanangkopsalbahehastagayunpamanpinabayaannunotirahannag-aaralroofstockaeroplanes-allsanademipinadakiptelefonernapakasipagbumangonhapag-kainaninfinitydoubledinadaananhiligbaldengrequiremahalinhapdinakasimangotbayadsakamaka-alismassakitpulispinangaralannakasandigkeepingproblemamagkaibatotoodyipnitaga-hiroshimakagabimissionganitoisinuotkatulonggloriakinagagalakamparogayunmantv-showspicsmangkukulamnegro-slavesjobsnagtaposbilinbanalgreatperwisyoguardabalatkasuutanlosssharmainemayabanghulihankinauupuantrainspelikulanagsagawanaiinitangatasiyakpamanhikantinapaykulisappasanglalimpatongwalngtsekoreainalagaananumangspecialpansamantalaestospiyanokailanmanmahahalikgelaipioneerdiin