Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Hindi siya malilimutin dati, ngunit nagbago ito nang siya’y tumanda.

2. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

3. Hinugot ko ang papel sa loob ng envelope.

4. El que espera, desespera.

5. Saan ka kumuha ng pinamili mo niyan?

6.

7. Mahirap magluto ng pulotgata dahil kailangan ng tamang timpla.

8. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

9. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

10. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

11. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

12. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

13. Lagi nating isipin na ang mga pagsubok sa buhay ay hindi dapat maging hadlang upang maipagpatuloy ang ating buhay.

14. Nakatanggap si Nicolas ng sulat galing sa ninanais niyang paaralan, siya ay nakapasa dito.

15. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

16. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

17. Los alimentos ricos en antioxidantes, como las bayas y los vegetales de hoja verde, pueden ayudar a prevenir enfermedades crónicas.

18. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

19. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

20. Maglalaro ako ng tennis. Ikaw?

21. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

22. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

23. May isa sa mga taong bayan ang nakakita nang isubo ng matanda ang bunga.

24. Beth ang pangalan ng matalik kong kaibigan.

25. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

26. Hinalungkat na niya ang kahong karton na itinuro ng ina.

27. Kumain ako ng sinigang sa restawran.

28. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

29. They are attending a meeting.

30. Opo. Magkapareho po ba ang disenyo?

31. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

32. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

33. Lumabas ng simbahan ang mga tao nang limahan matapos ang misa.

34. Bakit ba nagkaroon ng landslide at baha?

35. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

36. Gusto kong bumili ng bagong cellphone, datapwat ang aking kasalukuyang cellphone ay gumagana pa naman.

37. The culprit who stole the purse was caught on camera and identified by the victim.

38. Bakit wala ka bang bestfriend?

39. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

40. Mabilis manakbo ang aso ni Lito.

41. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

42. A los 13 años, Miguel Ángel comenzó su aprendizaje en el taller de Domenico Ghirlandaio.

43. Ang maliit na aso ay tuwang-tuwang hinahabol ang bola.

44. Ailments are physical or mental health conditions that cause discomfort or illness.

45. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

46. Ang pagiging malapit sa kalikasan at paglalakbay sa magagandang lugar ay nakagagamot sa aking kaluluwa at nagbibigay ng kapayapaan.

47. Hindi ko alam kung magiging okay ka dito, pero gusto ko lang itanong - pwede ba kita ligawan?

48. Ang mga manggagawa nagsisilbi sa kanilang kumpanya upang magtrabaho at kumita ng pera.

49. Sino ang pupunta sa bahay ni Marilou?

50. Ilang taon ka tumira sa Saudi Arabia?

Similar Words

popularize

Recent Searches

popularsumasakitpongdibapagpapasakitnahihiloinihandamanghulidissemataraynahigasundaeelectronicassociationadoptedblusamanuksobuenahinognicobutchstonagtutulakkinsefilmsnapatinginyatamegetbilerselltoothbrushwritinghangaringfurlossbitiwanlapitanadicionalescapitaltransmitsblusangonlineattractivemangingisdamagsusunuranpageanimpinalutoneedkontramarkedcheckslikelyschooldecisionsarbejdsstyrkelayout,rateiospupuntaencountercoachingbinabaancompartenginisingtanawinitimfuncionardonetwinkleayudapresssutilmethodsprocessdoesusingprogramshatebehaviorvanfutureilingevolvedaggressionreleasediginitgithellonagpakunotkatuladmaliitlooblumuwaspalipat-lipatvirksomhedernamulatbuung-buolumiwanagerhvervslivetdahan-dahankelanactualidadnag-iimbitanagsuotlolananonoodorkidyaskinalimutanhinampaslalosumimangotaaisshaabotadecuadosalesgabinggisingpakisabirabbaforståayawandrespagputipaskongkahilinganmagtipidcoalgrammarsinampalhitikteachnilulonnaritofialuisdulaplaysibabamagbubungacreationstandtrainingbeyondimpactedinilalabasnaninirahannagbakasyonpare-parehonagtitindamakikipag-duetonakabulagtangnakakadalawnakapagreklamomagpa-checkupnaglalakadagricultoresnagkikitanagbanggaanpagluluksanamumulaklaknakaliliyongnagkakatipun-tiponnagpaiyaknagandahanmag-babaitsikre,napapatungonaglipanangkikitasaleclubpamanhikannagkakasyanakatayomagpaniwalananghihinamagasawangnagtungoressourcernenagmakaawamerlindapangungutyapinagalitanmagkakailagayunmanpagpapakilalanagmungkahimakauuwiyakapinmagpagupitmahinapandidirimahiyamakabilimakukulaytangekslumamangmahiwaganakauwimagdoorbell