Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkaligaw sa landas ng katwiran.

2. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

3. Sino ang kasama niya sa trabaho?

4. Ano ho ba ang masarap na putahe ninyo?

5. Pumupunta siya sa Amerika taun-taon.

6. La paciencia es una virtud que nos ayuda a ser mejores personas.

7. Lalong nag-iyakan ang dalawang bata.

8. Representatives can be found at various levels of government, such as local, regional, national, or international.

9. Me gusta mucho dibujar y pintar como pasatiempo.

10. Dumating siya mula sa Bikol kahapon ng umaga.

11. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

12. Las redes sociales pueden ser una fuente de entretenimiento y diversión.

13. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

14. The company used the acquired assets to upgrade its technology.

15. Ada asap, pasti ada api.

16. Lumiit ito at nagkaroon ng mga mahahabang paa.

17. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

18. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

19. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

20. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

21. Nationalism can also lead to authoritarianism and repression of dissent.

22. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

23. The pretty lady walking down the street caught my attention.

24. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

25. At sa paglipas ng panahon, naging malakas na ang lalaki na nakilala nilang Damaso.

26. Les enseignants sont des professionnels de l'éducation qui travaillent dans les écoles.

27. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

28. Using the special pronoun Kita

29. Anong pinag-usapan niyo ni Mommy? biglang tanong ni Maico.

30. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

31. Let the cat out of the bag

32. Sa Sabado ng hapon ang pulong.

33. Habang naglalaba ang kanyang ina ay walang tigil namang naglalaro si Juanito.

34. Ang pagtanggap ng aking pagsisisi at pagpapatawad mula sa taong nasaktan ko ay nagpawi ng aking kalungkutan at panghihinayang.

35. Promise yan ha? naramdaman ko yung pag tango niya

36. Kailan nagtapos ng kolehiyo si Peter?

37. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

38. Nagkalat ang mga balat ng prutas kahit saan.

39. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

40. La paciencia es necesaria para alcanzar nuestros sueños.

41. Naglalambing ang aking anak.

42. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

43. Nous avons décidé de nous marier cet été.

44. The website's analytics show that the majority of its users are located in North America.

45. Ano ang ginagawa mo nang lumindol?

46. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

47. Kukuha na ako ng lisensya upang makapagmaneho na ako.

48. Naglalaba ako ng mga sapatos pagkatapos ng malakas na pag-ulan para hindi ito maaksididente.

49. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

50. Their primary responsibility is to voice the opinions and needs of their constituents.

Similar Words

popularize

Recent Searches

instrumentalpopularyearsnanangisasukalnumerosashinandenhitapagnag-alalaisinalangbayaranangelahinilaogsåkahalumigmiganlalakisighgraduationpinag-usapanibinubulongphilosophicalhimihiyawforskeldisyembremumopaladkalaromaasahandevelopmentknow-howreboe-commerce,tatayohinanapdamimandirigmangmakipagtalomaghintaypamamalakadadvertisingdamingheretugonpamilyamagbantayanumangincluirmamimisssuriintissuefacebookpakiramdamheld1990vivababalikutak-biyahamakhawlaitemshaskinagigiliwangbagkus,harapinkanyaharithankslangyapumansinhardinnahulaantumatawadiloilocultivar1000ahitharapanmagbagoshowsmaarawbukodbinabatichoosekingvedfencingumakbayuncheckedpinangfonoshaponihahatideleksyonearlysinabihanapbuhaytuwawalanghitsuraiponglabishawiumagangkunwastarredmarketing:nakabulagtangskillstillmag-aamamagpa-paskotagumpayhampaslupapangalanmagkahawakvampiresnagreklamoslavengalayuanbukasdontgawinmarketingbairdhalu-haloexportnakabaliksolaritinagonglalabakirbypalayonapatulalainspirasyonhawakanarawleonangampanyaautomationgasolinaradyohila-agawanevnebarcelonadesisyonanhahahalamesapulgadaoverherramientamaka-alisinfluentialpamilihanhalakhakpag-indaknapag-alamanbotokadaratingmagtrabahobugtongkakaininmanuscriptnanlakilakadnanaypagkabiglanuhpinadalaledcualquiernakakinalakihandaanggumuglongpagsambanakauwipinakamasayanapakagandagustongmagsisimulananditopag-uugalisapagkatnakaraangpaglalayagstudentthroughoutkalyetaonsciencepaggawaparoroonauugod-ugodsagingakalainghabilidadesnakakaenrich