Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

2. Higupin ng basang tuwalya ang tubig sa mesa.

3. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

4. Umalis na siya kasi ang tagal mo.

5. Ayaw niya ng maarte at mataas na presyo kaya lagi siyang nagbabakasakali sa mga mababang halaga.

6. All these years, I have been learning and growing as a person.

7. Ang mga hayop sa gubat ay naglipana din.

8. Ohne Fleiß kein Preis.

9. La labradora de mi amiga es muy obediente y siempre viene cuando la llaman.

10. Hindi sadyang nasaktan siya nang malaman niyang iniwan siya ng kanyang kasintahan.

11. I just got around to watching that movie - better late than never.

12. Magsuot ka palagi ng facemask pag lalabas.

13. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

14. Nagsisunod ang mga kawal sa palasyo pati ng mga nasasakupan.

15. Saan-saan kayo lumibot sa Amerika?

16. El agua desempeña un papel crucial en el funcionamiento de los ecosistemas.

17. Salatin mo ang upuan upang matiyak na tuyo ito bago ka umupo.

18. Ginaganap ang linggo ng wika ng Agosto.

19. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

20. Matagal-tagal na siyang tulala, hindi niya alam kung ano ang gagawin.

21. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

22. Si mommy ay matapang.

23. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

24. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

25. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

26. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

27. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

28. Ano ang gagawin ni Trina sa Oktubre?

29. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

30. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

31. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

32. El curry tiene un sabor picante y aromático que me encanta.

33. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

34. Si Hidilyn Diaz ay isang inspirasyon para sa maraming Pilipino, lalo na sa mga kabataan.

35. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

36. Mahina ang kita ng kanyang ina sa paglalabada; mahina rin ang kanyang kita sa pag-aagwador.

37. She is not playing with her pet dog at the moment.

38. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

39. Nakakatakot ang gagamba na kanyang nakita.

40. Alam kong parang biglaan, pero sana pwede ba kita makilala?

41. Nationalism can also lead to xenophobia and prejudice against other nations and cultures.

42. May tatlong bituin ang watawat ng Pilipinas.

43. Sa pagbisita sa hardin, ang mga bulaklak ay nagbigay ng mabangong amoy at kagandahan sa kapaligiran.

44. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

45. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

46. Magkano ang polo na binili ni Andy?

47. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

48.

49. Ano pa ho ang pinagkakaabalahan ninyo?

50. Kailangan ko ng lumisan mahal ko.

Similar Words

popularize

Recent Searches

popularbangkobalangmeronplantasbranchesataiconcomplicatedlorifull-timecombatirlas,kumananrabemisatoretecentersuotredigeringvisualgeneratedalignsbowiponghumbleenfermedades,paghihirapsilbingperpektoentranceisinagothayaanpinasalamatanumuwinagrereklamotonydullpasensyaadverselyupuankilongnangagsipagkantahanpatawarinitinaasabalananditomakikiligostudynationaljulietmagwawalagawinpublishingcoinbasefanshouseholdsmapfascinatingmassachusettssampungcomputereorasanmagkasakitpromisemagbantaysawakristokasiyahanmessageibinigayownhousebutogabeideyanagdabognababalotmahinangexpandednewsofabastamagalingpinagpalaluansinungalingkutoddiseaseyoutubeanubayanforskelsakayplanning,isinisigawtamaanpanigpagdidilimsinapokfiagreatdiamondlingidomgcapitalcellphonelupamournediginitgitcharitableremotehellotoolthoughtsaggressiondancebadingvariedadhinampashinahaplossarongbinawianprotegidobumalikuhogmakapaibabawnagsisipag-uwiannanghahapdimakawalafacemaskmorningdoble-karanapanoodtig-bebenteiwinasiwasumiiyakclubnasasakupanmakakawawakasangkapansalamangkeromakikiraanmaglalakadpinagpatuloyskyldes,tumawanagagamitartistmagdamaganumiinomnagsuotmahuhusaynatinagregulering,hahahanatabunanperpektingkamandaglumabastaga-ochandonagtanghalianumokayikatlongunanreorganizingminerviecramesisikattamarawnapaangatkakayananlosdalangoktubresicaisamaangalcolorcarriesyeyarkilainiisippagkatitutolsoccerposporoyatamansanasmatarayiskedyulstockscompositoresmagpapapagodtinigpinagtatalunanmakitangillegalitinanimgreenhillslumangduliyou