Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

2. Sa computer nya ginawa ang disensyo ng kanyang invitation.

3. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

4. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

5. Wala akong pakelam, basta nasa ref ng bahay ko akin!

6. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

7. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

8. I took the day off from work to relax on my birthday.

9. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

10. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

11. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

12. Protecting the environment requires a collective effort from individuals, organizations, and governments.

13. Muchas ciudades tienen festivales de música que atraen a personas de todo el mundo.

14. Gusto ko hong gumawa ng reserbasyon.

15. Nag-aaral ka ba sa University of London?

16.

17. Papaano ho kung hindi siya?

18. Ano ang gusto mong panghimagas?

19. Está claro que hay diferencias de opinión en este asunto.

20. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

21. Sa aking probinsya, tawag sa pulotgata ay "latik".

22. Ignorar nuestra conciencia puede hacernos sentir aislados y desconectados de los demás.

23. Ang kalayaan ay hindi lamang tungkol sa pagiging malaya sa pagpapahayag ng ating mga saloobin, ito rin ay tungkol sa pagpili ng ating mga sariling desisyon at pagpapasya sa ating buhay.

24. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

25. Los sueños son la manifestación de nuestra creatividad y nuestra capacidad de imaginar un futuro mejor. (Dreams are the manifestation of our creativity and our ability to imagine a better future.)

26. Limitations can be financial, such as a lack of resources to pursue education or travel.

27. Hindi ka sanay sa matinding init? Kung gayon, manatili ka sa lilim o sa malamig na lugar.

28. Hindi niyang inaasahang may dadalaw sa kanya sa mahabang panahon inisp niya na imposible ito

29. Women's relationships with their bodies have been shaped by societal expectations and cultural norms.

30. Bukas na pala ang araw ng kalayaan.

31. Sana makatulong ang na-fund raise natin.

32.

33. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

34. Ang mga paaralan ay maaaring magpakalat ng kamalayan sa mga mag-aaral tungkol sa panganib ng paggamit ng droga.

35. Tuwing Marso hanggang Hunyo ang summer break

36. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

37. Ang hindi pagtulog ng sapat na oras ay maaaring magdulot ng pagkapagod at kakulangan sa enerhiya sa araw-araw na buhay.

38. Ininom ni Henry ang kape sa kusina.

39. Ahhh...wala! Bakit ba, nagdadasal ako noh!

40. Ang bulaklak ay mabango at nakakapagbigay ng kasiyahan sa amoy.

41. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

42. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

43. Nang magbabayad ako ng pinamili ko't kapain ko ang bulsa ko, e wala nang laman!

44. Limitations can be a source of motivation to push oneself to achieve more.

45. Dahil sa hiya, tuwing gabi na lamang ito mag-isang lumilipad upang humanap ng kanyang makakain.

46. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

47. A father is a male parent in a family.

48. Bumili ka ng blusa sa Liberty Mall.

49. Ang mga Pinoy ay kilala sa pagiging masayahin at matulungin.

50. Hinawakan niya iyon sa magkabilang tirante.

Similar Words

popularize

Recent Searches

populariintayinlumiwanagtodasbiyernesbinibilangpaki-ulitpaosfinishedimageskinatatakutancultivationtumahanpagpapatubothingsproblemarebolusyoneverythingmalapadtiboktuladcoachingadobotasabayaningnaglalatangomfattendetumakas1876tumigilpare-parehoexperience,patongnahahalinhanaudiencemanggagalingnegro-slavesthingnangyariestablishedkumaliwainiirogipinalitnanayanibersaryobahagyanganaytangeksdedicationumiiyaknagandahanpakisabigiverhimselfapoyfencingcitizenritomacadamiacrucialtinigilantonightsimbahanatulogslavepalaginagpagupitcomunesnogensindectricasnagbiyaherolledpinamumunuankabibimini-helicopterkingbahalatatlokinakabahankilopookinilabashitsurasaberumangatmatabamaskcardmadalastabalalatenderkumaripasblessblazingtinigilbesidesakmapagpanhiktignanlalowritemalayamakahiramnapapasayainisprobablementetakebefolkningen,relonapailalimpansamantalaannahabittungonakitatamispagkabiglawouldkaliwapupuntapresidentialpagmasdanibinaonyamankasaysayannahantadgenerationerchangepaakyatsumigawninyowhilelansanganandresworldbulsaseenfollowingataquesnagbasafindbihirangmasayagaanokalayaanulapnanggigimalmalnunonailigtasganuncreatingmalakingwalletsourcetechnologicalrelevant18theconomybahabarnessumasakaytiptodonararapatbalatinferioresnagliliwanagpasensyaplasanagmadalingrespektivebasagagambaparoespecializadasmagbubukidmasternagkakakainmanakbounahinmetodisktamangmiyerkulesbulongipinagbibilipagsisisimelissanagbungamangingibigmatsingnapakamisteryosokaloobangnoonkasoyhimayinnatinag1929titiratinig