Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Det er vigtigt at give børn en kærlig og støttende opvækst.

2. Iniisip ko ang aking mga pangarap, datapwat alam kong ito ay magiging mahirap abutin.

3. The sports center offers a variety of activities, from swimming to tennis.

4. El perro de mi amigo es muy juguetón y siempre me hace reír.

5. Ang aming washing machine ay madalas magamit dahil halos araw-araw kaming naglalaba.

6. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

7. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

8. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

9. Pumupunta siya sa Amerika taun-taon.

10. Ang kalayaan ay isa sa mga pinakamahalagang karapatan ng bawat tao.

11. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

12. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

13. Nagkakasya rin ang pamilya na mamulot ng mga tirang pagkain na maaari pang pakinabangan.

14. There were a lot of flowers in the garden, creating a beautiful display of colors.

15. We need to optimize our website for mobile devices to improve user experience.

16. Bestfriend! impit na tili ni Mica habang palapit sa akin.

17. Babalik ako sa susunod na taon.

18. Ang pagtatayo o pagsali sa isang komunidad o samahan ay nakagagamot sa aking pakiramdam ng pagka-bahagi at pagkakakilanlan.

19. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

20. Sa condo ko. nakangiti niya pang sagot.

21. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

22. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

23. Dumating ang mga kamag-anak ni Fe.

24. Miguel Ángel murió en Roma en 1564 a la edad de 88 años.

25. Sweetness can be balanced with other flavors to create a harmonious taste experience.

26. Naibaba niya ang nakataas na kamay.

27. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

28. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

29. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

30. Ang buhay ay isang mumunting paraiso lamang.

31. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

32. Larry Bird was a versatile forward and one of the best shooters in NBA history.

33. Naglalambing ang aking anak.

34. Kailan tayo puwedeng magkita ulit?

35. Ang galing nya magpaliwanag.

36. Mas lumakas umano ang ekonomiya matapos buksan muli ang mga negosyo.

37. Nakakamangha ang paglalagay ng pulotgata sa bao ng niyog upang makagawa ng kakanin.

38. Mahalagang magtiwala sa ating kakayahan upang maabot natin ang ating mga pangarap, samakatuwid.

39. Gusto kong maging maligaya ka.

40. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

41. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

42. Wag kana magtampo mahal.

43. Women have often been the primary caregivers for children and elderly family members.

44. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

45. Påskedag fejrer Jesu opstandelse fra de døde og markerer afslutningen på Holy Week.

46. Ang mga magsasaka ay nagtatanim ng mais para sa kanilang kabuhayan.

47. Siya ang pangunahing lider ng Katipunan sa Cavite.

48. She does not gossip about others.

49. Dumaan ako sa silid-aralan upang magpasa ng papel sa guro.

50. Susunduin ni Nena si Maria sa school.

Similar Words

popularize

Recent Searches

santopopularsummitlaylaynaritoanumanpuwedebornmayamankatedralna-suwayhvordannapagkaloobangmakingoutpostefficientaidtiposhelpsupportsparkpowersnagkakakainautomatiskprimerstevekulisapbakecarsnagbababamagka-apoeconomicsakupinisinuotganangbankkusinerobestfriendkikitabaranggaynakasakitfotoslibagsaan-saangasmennakabawihearbiyas1950smasyadonghumanonakapagreklamoactorreserbasyonhealthierwaterbayadikinabubuhayscientistcafeteriagawingprinsipengdiscipliner,sellingpanunuksopagpapatubosumayacampaignsinulitipinangangakedukasyonpaglisaniyakkasaganaanpagkaawakinamakatawanaglipanangsementeryoblusasinundoerlindamasiyadomaintindihansanatatawagtumawagplayspaglalayagmakuhangmagulayawdinicasesnasaangkaniyaamonakasuottogethersunud-sunodseryosongpinilingbansangbulaknahuliupuannapakasipagkalarolamankargahaninfusionestuyodreamnahigitandireksyonpasokpogiforståikatlongskillnapatulalapinyapiratamamarilbumuhosmedikalmenoshimselfinantaynauntogroonmikaelakamanapagodpalakolmangahastrackcryptocurrency:bakuransipasikipnakinigpagbebentanaghuhumindigsagasaanhinugotmightputoltmicakumukuhapagpapakalathereipinalitmahahabatinitindasyatraveldoonnaglarostopsumapitbironglalabadrayberkombinationcomunespalagikonsultasyoncakepansitcovidnakilalamamayatinignanpakibigyankatieartsyukoalapaapalignsnapapatungomasarappagpanhiknagpalutogrammarunderholdernaguusaploricreationhinukaykumakalansingnagpasamatungkodteachcleanmagnifyskillsnagdarasalwindowsundae