Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Don't cry over spilt milk

2. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

3. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

4. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

5. Ang bituin ay napakaningning.

6. Ilang kutsaritang asukal ang gusto mo?

7. Hi, we haven't been properly introduced. May I know your name?

8. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil ito ay maaaring maging dahilan ng depresyon at iba pang mental health issues.

9. Tinigilan naman ni Ogor ang panunukso.

10. Dumating na ang araw ng pasukan.

11. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

12. Hindi ako komportable sa kanilang plano kaya ako ay tumututol.

13. There are a lot of benefits to exercising regularly.

14. Ang tindera ay nagsusulat ng mga listahan ng mga produkto na dapat bilhin ng mga customer.

15. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

16. Gracias por escucharme cuando más lo necesitaba.

17. En invierno, las personas disfrutan de bebidas calientes como el chocolate caliente y el té.

18. A couple of raindrops fell on my face as I walked outside.

19. Sa likod ng kalsada, nagtatago ang magnanakaw na may dala-dalang sako.

20. Nagalit ang matanda at pinalayas ang babaeng madungis.

21. Sweetness can be a source of comfort and pleasure for many people.

22. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

23. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

24. Samahan mo muna ako kahit saglit.

25. Nagdulot ng kakulangan sa tubig ang matagal na tagtuyot sa kanilang lugar.

26. Pumasok ang mga estudyante sa klase nang limahan.

27. He does not break traffic rules.

28. Ant-Man can shrink in size and communicate with ants using his helmet.

29. Jacky! si Lana ng sagutin ko ang CP ko.

30. Sa brainly ako madalas nakakakuha ng ideya.

31. The company suffered from the actions of a culprit who leaked confidential information.

32. Naaksidente si Juan sa Katipunan

33. Susunduin ni Nena si Maria sa school.

34. He is having a conversation with his friend.

35. Huwag kayo maingay sa library!

36. Il est également important de fixer un budget et de limiter son risque pour éviter de perdre plus que ce que l'on peut se permettre.

37. Ganun? ok. disappointed na sabi ko.

38. Hindi ka ba papasok? tanong niya.

39. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

40. Ang bobo naman ito, di pa nasagutan ang tanong.

41. Ang mga parangal na natanggap ng atleta ay nagpapakita ng pagpapahalaga at itinuring na tagumpay sa kaniyang larangan.

42. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

43. Kapag dapit-hapon, masarap kumain ng merienda habang nagmamasid sa sunset.

44. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

45.

46. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

47. No pierdas la paciencia.

48. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

49. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

50. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

Similar Words

popularize

Recent Searches

popularsumigawdisposallumaking1950sbinatakaffiliatetungogenerositykatagaarbejderhousekabosesayonsenatealexandertillisinalangbalancesgranadamancomienzanfakegabeamongorugamasdanspeechesipinadalaibigbrindarmatangumpaymulimuchosmanuelcigarettesprovealamresearchlarrymatindingpasyaandrewnakikini-kinitagitaraspreadcompleteableannaworkingpowersthoughtstiposuminomcommercialkatolisismogawinvelfungerendetungawpampagandalasingkalahatingkomedornararapatthroughtinuroprogresstiniopalagivirksomheder,miyerkolesnagpuyoskayabangansahigpanayjerrytagpiangglobalisinagotmagtanimhihigitnapilitangvetoiconicmayamangprouddeledetengkantadaexpertlockdownfacespeechmatabanangkapilingexamplenamungamaghahabinagsinetinataluntonpartskahongpagsagotasignaturapinigilanmasyadongvanprodujonakahugmagkasabaymakauwikinasisindakanpagkaraanagcurvebeautypaghaharutancasalandohitikexhaustedbinatangmininimizehomeshugisblusailogmagdatoretemadurasbilugangmerrytuwingomelettewariplaysadventataperajamessatisfactiondrewaudititinaliumanotanongnapaiyaknawawalanag-poutpagtutolsasayawinmakangitipagpapasannagpaalampamamasyalkalalakihanmagsasalitatiniradorkapangyarihangkapangyarihannagpapakainpaki-translatetindahanmaibibigaysisikatindustriyarodonatinungodiyaryogumigisingtutusingumuhitnasagutannuevosgubatumuponabigaykastilapaliparinadvancementkamalianpasahemangiyak-ngiyakhinabolbagalbandaprobinsyamaniladiaperbookstasasakaydalawintransportbantulotmaramotlugawarturomartiannagniningning