Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. La tos aguda dura menos de tres semanas y generalmente se debe a una infección viral.

2. Ano ang ginagawa mo nang lumindol?

3. Bukas na lang ako pupunta sa bangko.

4. Wala akong maisip, ikaw na magisip ng topic!

5. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

6. Ang tunay na kayamanan ay ang pamilya.

7. The song went viral on TikTok, with millions of users creating their own videos to it.

8. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

9. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

10. Argh. Parang batang bading naman eh. Anubayan.

11. Sayang, apakah kamu bisa mengambil anak-anak dari sekolah nanti? (Darling, can you pick up the kids from school later?)

12. I hate it when people beat around the bush instead of just getting to the point.

13. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

14. La anaconda verde es una de las serpientes más grandes del mundo y es conocida por su capacidad para aplastar a sus presas.

15. Nakikinig ako sa mga kanta ng Bukas Palad tuwing Linggo sa simbahan.

16. Nagpunta si Emilio Aguinaldo sa Hong Kong pagkatapos ng Biak-na-Bato.

17. I love the combination of rich chocolate cake and creamy frosting.

18. Sadyang mahirap ang pag-aaral ng calculus, ngunit sa tulong ng tamang libro, maari itong maging mas madali.

19. Ano pa ho ang dapat kong gawin?

20. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

21. Min erfaring har lært mig, at tålmodighed er en dyd.

22. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

23. Huwag kang pumasok sa klase!

24. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

25. Salamat sa alok pero kumain na ako.

26. Madami ang nawalan ng trabaho dahil sa pandemya.

27. Pinili ng mga magulang ang pinakamalapit na paaralan sa kanilang tahanan upang hindi na mahirapan ang mga bata sa pagbiyahe patungong silid-aralan.

28. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

29. No choice. Aabsent na lang ako.

30. Sumaya ang mundo ni kuya dahil sa iyo.

31. Okay na ako, pero masakit pa rin.

32. Siya ay tulala at di maka-react nang maigi sa nangyayari sa kanya.

33. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

34. Ilang oras na ang nakalipas ngunit hindi pa nauwi ang batang si Ana, nagpatulong na si Aling Rosa sa mga kapit-bahay na hanapin si Ana.

35. Tinanong niya ang mga kapitbahay kung nakita nila ang kanyang anak.

36. Apa yang bisa saya bantu? - How can I help you?

37. They are not running a marathon this month.

38. Kung maka-yo 'tong next partner ko kala mo taga kanto.

39. Ang ganda ng swimming pool!

40. El agricultor utiliza técnicas de riego para asegurar el crecimiento óptimo de sus cultivos.

41. Napahinto rin kami dahil kay Jenny.

42. Sa ganang iyo, may pag-asa pa ba ang ating mundo sa kabila ng lumalalang polusyon?

43. Sa di-kawasa ay dumating ang malungkot na sandali.

44. La physique est une branche importante de la science.

45. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

46. Happy Chinese new year!

47. Saan ka kumuha ng pinamili mo niyan?

48. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

49. Ngunit marumi sila sa kanilang kapaligiran.

50. Te agradezco por estar siempre ahí para mí.

Similar Words

popularize

Recent Searches

happenedpopularkuwebainaapiconvertingtipclassmateinterviewingworkingpagtatakapagtuturonicetuyonginsidenteobserverertigretoretechunnangyarimaasahankalayaanpinagkaloobanpaksamaynagugutomchangemaibabalikmensundeniablenakasimangotpakisabirosellehalalanartistassumimangotexperience,sumpunginshuttumatakbolumiwanagsharehumalonagtutulunganinventadolilymahirammagtipidsigurokaano-anomaulitbuwalfansluisasukallayuninlikeenforcinglockdownfuncionessumalireviewsakimbilanggotodastsinelassinikapsumasambabusilakkaugnayanyunmabaitkumbentolalakenagisingcrucialemocionantemagpapagupitibinubulongglobalisasyonpagtiisanwariiikotpanginoongiraycaracterizakastilangmagisipfederalumuwilandasarbularyohalu-halolumamangkabutihankagipitanpakikipaglabanuulaminnakalockyumaoyumabangmagsugallargerdalawmagpunta1876animoyamparobulsapagkakalutomusicianisinulatpodcasts,montrealnanlalamigfilipinapinuntahanatensyongnakaakyatbakanteperpektingpinangalanannakapagproposepakinabanganshiftelecttabamarkednaggingcrazypinagtabuyanpayongabstainingt-shirtlandmartessupilinwasteparkenapatawagnabiglapasensyabawatbarongteachingsutilizanmagkanomaaksidentepakibigaydulotinagrinsxixasthmaiilananywhererefersoutpostburdendogamongcriticsmiyerkulesmessagetaoshanapbuhaybutobukaskumilosnagsilapitpumuntathemkahalumigmiganrefhahatodonanaykanilangmensahemaipantawid-gutomdamingpananakottaaskuryentenagliliyabkawawangdyipkayang-kayangsemillascementedbigkisparaanallowingnaabotkapilinggapnaismediumkapintasangestarpinauwi