Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Iinumin ko na sana ng biglang may umagaw.

2. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

3. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

4. Emphasis is often used in advertising and marketing to draw attention to products or services.

5. Gracias por hacer posible este maravilloso momento.

6. Walang tigil sa paghalakhak ang matanda mula sa kanyang kinatatayuan.

7. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

8. Ipanlinis mo ng sahig ang basahan.

9. Bitbit ng isang kamay ang isang pangnang sisidlan ng kanyang pamimilhing uulamin.

10. Hayaan mo akong magbayad ng lahat.

11. Bukas ang kupasing damit na giris, nakahantad ang laylay at tuyot na dibdib.

12. Nahawa ako ng kuto sa kapatid ko.

13. At isang araw nga, nagpasya sina Damaso at Magda na tumakas at mamuhay sa ibang lugar.

14. Ang bango ng lupa pagkatapos ng ulan ay nagdala ng mabango at sariwang simoy.

15. At tuluyang nagliwanag ang buong paligid at nawala ang dalawa.

16. Mga guro sina G. Santos at Gng. Cruz.

17. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

18. Athena.. gising na. Uuwi na tayo maya maya.

19. Nationalism has been a driving force behind movements for independence and self-determination.

20. Umiling siya at umakbay sa akin.

21. Pakibigay ng pagkakataon ang lahat na makapagsalita sa pulong.

22. Håbet om at opnå noget kan give os styrke og energi.

23. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

24. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

25. Nang magbabayad ako ng pinamili ko't kapain ko ang bulsa ko, e wala nang laman!

26. Bumili siya ng dalawang singsing.

27. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

28. Kung may isinuksok, may madudukot.

29. They have been cleaning up the beach for a day.

30. Let the cat out of the bag

31. Wala na ang beyblade at ang may-ari nito.

32. Tila may nagseselos sa bagong kasapi ng grupo.

33. Saka na yun, pag fiance ko na sya saka ko sya liligawan!

34. Ang hardin ng aking lola ay mayabong na puno ng mga bulaklak.

35. Wala kang kuto noh? nabigla ako ng magsalita sya.

36. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

37. Hindi ba nagdaramdam ang nanay at tatay mo?

38. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

39. If you want to get the best deals at the farmer's market, you have to be the early bird.

40. nadama niya ang bagong tuklas na lakas niyon.

41. Nagliliyab ang kandila sa altar habang nagsasagawa ng dasal.

42. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

43. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

44. Magdamagan ang trabaho nila sa call center.

45. A couple of raindrops fell on my face as I walked outside.

46. Nag-aalala ako para sa kalusugan ko, datapwat hindi pa ako handa para sa check-up.

47. If you think she'll forgive you, you're barking up the wrong tree.

48. "Dogs come into our lives to teach us about love and loyalty."

49. At have en sund samvittighed kan hjælpe os med at opretholde gode relationer med andre mennesker.

50. Have you tried the new coffee shop?

Similar Words

popularize

Recent Searches

popularmakabililtoprobinsyanawalangbabaibinilicompletamenteoperahannapipilitannagplayginawarankaharianpagdiriwanghalamanbumangonmabangisnagmistulanghastapaghamaksariwapagpapakalatpinalayasinfusioneskusineronanangispalanglangkaydulonag-away-awaymabutingdisyemprelaylaycomplicatedpagkalungkotteachamericavidenskabenkapagpnilitmilaaraypagtitiponhappyantoniopinunitsulokiyannapahintoeitherlibongpanalanginpagkainpananglawkagabielecttonotsinahidingbringwalletloobkinatatalungkuangsumindinaiwangobra-maestraasthmaarghnakainsumunodinterestmaasahantherapeuticsnapaiyakkinalalagyannananalongneverrelevantvotesoperativoscadenapopcornmanakboautomationginagawauwakaftertravelbansangbagkus,dennakuhaumalispaglalaithinigitacademypinaghaponkampeonsinabikakaibapamilihantalinokailanmannaglalarogayunpamanstoreschoolsinantaysinabadthemritwaldiagnosesnaglulutopossiblecafeteriamagnakawpaghingiipalinispasasalamattungkodtanghalirepublicsinceheartbeatkamiasibinubulongpondokumakaingenepagluluksabangkanggatheringtwitchpantalongterminodialledisinalaysayinangrestclassesnagtuturosumpainikawhanginwalabakeumiisodcompanyartistashinatidparisadyangasiaticandreashopeenapatinginsikipmaipantawid-gutomtokyoumagangnilangalapaapjuegosmagsabimagsusuotsumapitmakabawipagsalakaycommunicatesettingmagsimulalibagitemstapekinumutannasasabihanbangbalotunattendedmandirigmangmaaksidenteasignaturapokermumuraopportunitycarsnasasakupanrightsmournedmagsasakapatihinahaplosmagawitanmisteryomerchandisenahintakutantinangka