Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Limitations can be physical, mental, emotional, financial, or social.

2. The traffic signal turned green, but the car in front of me didn't move.

3. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

4. Nagre-review sila para sa eksam.

5. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

6. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

7. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

8. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

9. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

10. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

11. Pinili ng mga magulang ang pinakamalapit na paaralan sa kanilang tahanan upang hindi na mahirapan ang mga bata sa pagbiyahe patungong silid-aralan.

12. It's complicated. sagot niya.

13. She carefully layered the cake with alternating flavors of chocolate and vanilla.

14. Masamang droga ay iwasan.

15. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

16. Emphasis is an important tool in public speaking and effective communication.

17. Isang araw, habang nangangahoy si Mang Kandoy, nakakita ito ng isang kweba sa gitna ng kagubatan.

18. Ano ang pinapakinggan mo sa radyo?

19. Kailangang mabagal at marahan ang apoy.

20. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

21. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

22. Magtiis ka dyan sa pinili mong trabaho.

23. Drinking enough water is essential for healthy eating.

24. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

25. Kailangan nating magsumikap upang makamit ang ating mga pangarap.

26. Gusto kong mamasyal sa Manila zoo.

27. He was busy with work and therefore couldn't join us for dinner.

28. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

29. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

30. Mapapansin kaya sa dami ng 'yong ginagawa

31. Pasensiya na kayo, wala po akong relo.

32. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

33. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

34. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

35. Sino ang sumakay ng eroplano?

36. Hindi ako sang-ayon sa mga komento na narinig ko tungkol sa iyo.

37. Hit the hay.

38. I am not exercising at the gym today.

39. Walang mahalaga kundi ang pamilya.

40. Mathematical proofs are used to verify the validity of mathematical statements.

41. Sino-sino ang mga nagsibili ng mga libro?

42. Samantala sa kanyang pag-aalaga sa mga alagang hayop, nae-enjoy niya ang mga simpleng kaligayahan na hatid ng kanilang kakaibang personalidad.

43. Nagbiyahe ako sa Mindanao noong isang taon.

44. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

45. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

46. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

47. I don't want to cut corners on this project - let's do it right the first time.

48. Siya ay tulala at di maka-react nang maigi sa nangyayari sa kanya.

49. Ang daming kuto ng batang yon.

50. Ada juga tradisi memberikan kue atau makanan khas sebagai bagian dari perayaan kelahiran.

Similar Words

popularize

Recent Searches

popularpamimilhingvoresoffentligepinapanoodrecentlyaccessnahulisorrypamamahingapotentialthempagkakataongnapakaselososharkminamadaliginooyumabonginintaykumarimotnapailalimolahumanspaggitgitkatuwaannapakasipagnaibibigaytiktok,bulaklakmananakawpangyayaritig-bebentecreatedconstantkwelyomisyunerokababayangbalotumiilingpaymulilimatikdaanfakelabanfuryformassoongusting-gustoi-markjustinjanitukodsangkalanloveactorpahirapannagtinginantsuperiniibigsinungalinghinabolproductslagunakatagalankarangalanrealpumupuntabinatosummerngayowowpinyuankapatagansinehangubatcrecerhinatidtsismosaniyannanggigimalmalmaliliitnakataasnatigilangbilhanbibisitanagsisigawsalu-salomakauuwimagnakawkinagagalakmagkaparehohorsepuedenipagtatapatkawawangmagandang-magandajuliusmagdalapagbabagong-anyonagkitapinagtagponakabulagtangpagsasalitagustongaguarealisticmediantesiyangbinibiyayaannagpabayadkinauupuanlabing-siyamdadalawinpinahalatapagsalakaynaguguluhangnaglalambingpinagawamakikitulogmakabawimangahasnapatigiltumawanakakainsunhumahagokpag-aagwadorhumahabalockednapagtuunantig-bebeintenapiligelaipinangaralanperpektingpananglawaga-agalikasngunitleverageimpactimpenalwaysipinangangakpinilitlittlelalimpanatagipinansasahoglilikothingpinggamallstayoinnovationnilapitanpnilitmadalingparoroonapakaininmagsimulapaghamaklupapangleksiyonpagsisimbangpisngipuedeslumanghagdananorkidyashumabialayhveralamidumaagoswalongnaiinitanchildrentaperosaku-kwentasearchorugaeffortspinaladalexander1920supo1787amonilagangmostinteragererhearthumalakhakpinunitellenexperiences