Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

2. The telephone has undergone many changes and improvements since its invention

3. Mabilis manakbo ang aso ni Lito.

4. They have sold their house.

5. Mag-iikasiyam na nang dumating siya sa pamilihan.

6. ¿Qué fecha es hoy?

7. Ang pagtanggap ng aking pagsisisi at pagpapatawad mula sa taong nasaktan ko ay nagpawi ng aking kalungkutan at panghihinayang.

8. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

9. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

10. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

11. Mabibingi ka sa ingay ng kulog.

12. Les investissements peuvent générer des rendements significatifs, mais comportent également des risques.

13. Ma, wag mo akong iwan. Dito ka lang ma!

14. Naaksidente si Juan sa Katipunan

15. Some of her most famous songs include "No Tears Left to Cry," "Thank U, Next," "7 Rings," and "Positions."

16. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

17. Lights the traveler in the dark.

18. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

19.

20. Gusto kong bumili ng bagong cellphone, datapwat ang aking kasalukuyang cellphone ay gumagana pa naman.

21. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

22. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

23. Akala ko nung una.

24. Sa kalayaan, nakakamit natin ang tunay na katarungan at pagkakapantay-pantay.

25. Ano ang gustong palitan ng Monsignor?

26. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

27. Nagpunta ako sa Hawaii.

28. Maaliwalas ang simoy ng hangin sa probinsya.

29. Pinapairal ko ang aking positibong pananaw sa buhay upang hindi ako magkaroon ng agam-agam.

30. Nangahas ang manunulat na talakayin ang kontrobersyal na isyu sa kanyang aklat.

31. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

32. Her charitable spirit was evident in the way she helped her neighbors during tough times.

33. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

34. Ang mga Pinoy ay likas na masipag at maabilidad sa anumang trabaho.

35. Salatin mo ang kahon kung may natira pang laman.

36. They served a mouthwatering strawberry shortcake for dessert.

37. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

38. Maari mo ba akong iguhit?

39. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

40. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

41. ¿Quieres que le agregue un poco de picante a tu comida?

42. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

43. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

44. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

45. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

46. Maraming bayani ang nagbigay ng kanilang buhay upang makamit ang kalayaan ng bansa.

47. May I know your name for our records?

48. May himig pangungutya ang tinig ng pulis.

49. Hiramin ko ang iyong bike para sumali sa cycling event sa Sabado.

50. Mahalaga na maging bukas ako sa mga taong maaaring makatulong sa akin upang maalis ang aking mga agam-agam.

Similar Words

popularize

Recent Searches

wasakcharismaticeducationbumigaypopularpartyreservesbitiwaninantokbabeslordtsesnapunsolagitinanggapboracayagaveryatentopagehydelbriefimportantessakincardnahulisiyakerbcontestawang-awamakakatulongnatalotekstcongratsheyeasierlackelectionsrailkaringsourceshallirogperlabluemagdugtongrailwaysbusstudentaddressipipilitdinmacadamiafloornutrientesstonehamoperatecharmingagoskukuhacompanyngunitviewsresourcesnerissaelectronicpinalakingsharecesdaigdigeducationalageeyetargetkutoprogrammingbitbitevolvesolidifytoolkasingenternotebookestablishedbeyondhimigfencingtrespalantandaannagpaiyakbarongcomfortnanunuksopakiramdamitimkantiningnantagumpaymakikitalaki-lakinewnagsisigawikinakagalitmagbibiyahemagkaibanagpakitaginugunitamarahildoble-karakalayuanpronounpunong-kahoyhampaslupaculturalminu-minutopagkapasokpagpapasakittag-ulanmagalangpambatangkumakantapaki-ulitinvestmakatulogbisitanatigilangmahiwagapinuntahanmorningmangkukulamnagkalapitpagtataasinuminumiyaknakalockmasyadongpanindakulunganuulaminmagdamagannatinagbulalaspahabolmasaganangcualquieriniuwipamagatkapagtumatakbokanilasmallgagamitpapalapitnabigkasbayadnglalabahagdanannapilinakabaonvitaminunancynthiahinalungkatmagalithumihingibiglaannangingitngitarturogroceryumulanbinawianescuelasopomatagumpaymalambotkaragatantsinelastilatiyanmauntogalleligaligmaayosimbesiniisipelenakainisnocheexpeditedfarmknightsigloyeyofrecenbinibilangananiyasuotasthma