Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Hindi malinis ang mga tsinelas ni Lori.

2. Tuwing gabi, ang mga tao ay nagpapahinga at natutulog upang mag-refresh ang kanilang katawan at isip.

3. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

4.

5. Kaya lumaki si Pinang sa layaw.

6. El agua dulce es un recurso limitado y debemos cuidarlo y utilizarlo de manera sostenible.

7. Quiero expresar mi gratitud por tu paciencia y comprensión.

8. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

9. Ang "sa ganang iyo" ay ginagamit upang ipakita ang pansariling pananaw o opinyon ng isang tao sa isang partikular na isyu o sitwasyon.

10. Huwag kang maniwala dyan.

11. Ang sugal ay isang hindi maiprediktable na aktibidad na nagdudulot ng excitement at thrill sa mga manlalaro.

12. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

13. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

14. He was hospitalized for pneumonia and was on a ventilator for several days.

15. Kumaripas ng lakad ang matanda nang bumilis ang ulan.

16. Seek feedback, it will help you to improve your manuscript

17. Ang bawat mabangong lasa sa kusina ay nagpapahiwatig ng isang masarap na handa.

18. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

19. Arbejde er en vigtig del af voksenlivet.

20. Sa brainly ako madalas nakakakuha ng ideya.

21. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

22. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

23. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

24. Though I know not what you are

25. Si Marian ay isang sikat na artista sa Pilipinas.

26. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

27. Humayo ka at hanapin mo ang dalagang sinasabi ko para mabalik ang dati mong anyo, ang utos ng engkantadang babae.

28. This has led to a rise in remote work and a shift towards a more flexible, digital economy

29. Sumakit ang tiyan ko kagabi kaya ako ay biglaang nagka-sick leave.

30. Have you tried the new coffee shop?

31. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

32. Bakit nga ba niya papansinin si Ogor?

33. Kailangan mo rin ng malalim at malusog na lupa na may sapat na konsentrasyon ng nutrients

34. La realidad es que a veces no podemos controlar lo que sucede.

35. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

36. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

37. Have you been to the new restaurant in town?

38. Matapos ang matagal na paghihintay, ang aking pag-aalinlangan ay napawi nang dumating ang inaasam kong pagkakataon.

39. Kapag nagluluto si Nanay, ang buong bahay ay napupuno ng mabangong amoy ng pagkain.

40. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

41. Huwag magpabaya sa pag-save at pag-invest ng pera para sa kinabukasan.

42. Jacky! magkasabay na sabi nung dalawa.

43. La esperanza y los sueños son las llaves para la felicidad y la realización personal. (Hope and dreams are the keys to happiness and personal fulfillment.)

44. Wala kang pakelam! O sige its my turn na!

45. Gusto niya ng magagandang tanawin.

46. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

47. The meeting was cancelled, and therefore he had the afternoon off.

48. They are not attending the meeting this afternoon.

49. Ang kundiman ay nagpapaalala sa atin ng mga halaga ng pagmamahalan at pagka-makabayan.

50. Aaissh! biglang upo si Maico pagka-maktol.

Similar Words

popularize

Recent Searches

popularkuneabangankasoybinitiwansakimnagtatanonglumbaygearniyospecialcebubangataquespataynasuklamnapakatalinogownmayoisinamamagkapatidinaabotnaglalatangmahahanaynapakagandangryanpaghahabilalabhanunahinininomfar-reachingenglishbarrierstumikimprotestakahusayannagsasagotkalanpaki-translatedisenyoabononakapagproposekrusstatusctricassinunodpasigawnagsisipag-uwiantanodninyostandtsakameetmukhakahulugannyekapainhimselffiverrsakristansasakyanaudittinderaeithermalikotdidinghahatolkisapmatanagwikanginakalareservesmagtatanimstudiedincreasednagmistulangspentmagdaraospagkaraabantulotawarenapapasayapulgadapitakalumabas11pmmahihirapnagcurvesedentarylumikhaautomatictechnologiesnagbasabitawanimaginationaplicacionessobrabloggers,behalfenforcingbeyondcallinglumuwastilgangtracksaranggoladeterminasyonibat-ibangalignsbirthdaynakasakitsumasagotreserbasyontumingalahealthierinulitespigastokyohangganglaki-lakinanlalamignapasubsobtumagalbatakatiehelpedlatestorasimportantepaninginokaynapahintospajenayaripumilimahiwagapangarapkomunikasyonkasinagmamadaliofteiiwasanbahaymakikipaglaromonetizingdamdaminbangladeshcreationsiyamtigrepasswordsinodennesafebusyangtanaweventsrelievedreachmakatiiniwanltonaibabaniliniskindlerinluzipasokmusicaladgangnohisinuotpanindapakaininmamanhikankainanartistakusinerotelefonercelulareskakuwentuhankaninumankaninongsocietykinauupuanleksiyonpagkapasokgelaiswimmingpagngitikarangalandalawamaskikinahuhumalingandeathwishingpagkamanghapamanhikannenasarita