Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Le jeu est une forme de divertissement dans laquelle on mise de l'argent sur un événement aléatoire.

2. Tignan nyo. ngumingisi! May balak yan! Psh.

3. Agad niyang dinala ito kay Mang Sanas.

4. Kahit ang diyosang si Venus ay walang panama sa kaniya.

5. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

6. Magalang na hiniling niya ang tulong ng guro sa kanyang takdang aralin.

7. Ang mahal pala ng iPhone, sobra!

8. Puwede ba tayong magpa-picture na magkasama?

9. Mi amigo me enseñó a tocar la guitarra y ahora podemos tocar juntos.

10. Claro, haré todo lo posible por resolver el problema.

11. Niloloko mo ba ako? Ang lamig lamig pa eh!

12. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

13. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

14. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

15. Lumabas ng simbahan ang mga tao nang limahan matapos ang misa.

16. I have a craving for a piece of cake with a cup of coffee.

17. Ano ang gusto mo, sinigang o adobo?

18. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

19. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

20. May I know your name so I can properly address you?

21. Wala nang gatas si Boy.

22. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

23. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

24. Børn er en vigtig del af samfundet og vores fremtid.

25. Nagsisilbi siya bilang social worker upang matulungan ang mga taong nangangailangan ng tulong.

26. Doon nyo sabihin ang gusto nyong sabihin at doon nyo gawin ang gusto nyong gawin

27. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

28. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

29. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

30. Nationalism can be a source of inspiration for artists, writers, and musicians.

31. Bukas ay magpapagupit na ako ng buhok.

32. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

33. Sino ang pupunta sa bahay ni Marilou?

34. Jakarta, ibu kota Indonesia, memiliki banyak tempat wisata sejarah dan budaya, seperti Monumen Nasional dan Kota Tua.

35. Nagising si Rabona at takot na takot na niyakap ang kaniyang mga magulang.

36. You can't judge a book by its cover.

37. Sa katagalan, natanggap na niya ang panunuksong ito.

38. Maraming alagang kambing si Mary.

39. Tradisyon na nang mga Pilipino ang pagsisimbang gabi.

40. Umalis siya kamakalawa ng umaga.

41. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

42. Ang Ibong Adarna ay may tatlong kapatid na naghahangad na maagaw ang mahiwagang ibon para magamit sa kanilang sariling kaharian.

43. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

44. Natandaan niya ang mga panunuksong iyon.

45. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

46. Ang mga bayani ay nagpapakita ng malasakit at pagmamalasakit sa kapwa tao.

47. Ayaw ng Datung paniwalaan ang mga aral na itinuturo sa Katolisismo.

48. Recycling and reducing waste are important ways to protect the environment and conserve resources.

49. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

50. Las redes sociales son una parte importante de nuestras vidas hoy en día.

Similar Words

popularize

Recent Searches

popularbumigayhousetransmitsblusangpaghingihomestradicionalsapagkatbairdlordfurbotoabrilfigurebadingcheckslikelyipapahingatradisyoniigibusingknowledgewhethergeneratedryannerissapootikawbosesna-suwayallmalalimpalaymahahanaymasayang-masayangbinatotitserobviousniyansagotjankatawantemperaturacommunicateriquezadilasusunodnatakotpag-uugalipagtatanongverygusting-gustomasipagmagalangbawatginagawabuslocontrolagivercomunicarsevanmalulungkotpaki-chargepinapataposkalayuansino-sinonagpakunotnaiyakmakapalagmasayahinpinakamaartengsundhedspleje,makalaglag-pantykumakantachristmaspatakbongmagselosika-50bahaginag-iisangeconomicsahodherramientaspinalambotbaoadvertising,hinagud-hagoddistansyananghihinakalakihannakakapasoklumiwagpamahalaanmagpapabunotmagtanghalianmagaling-galingmahabapinahalataumagawbumaligtadcorporationnailigtasnatitiramalasutladiliginmatangkadliligawanforståpromoteelenarememberedmahalinpangilbinibilangdomingosandalibigyanbinanggamanghulitinikritotaposibigresignationmaissergumalingonenaggalalapitanhitikmustaumentaroliviawidespreadsubjectlegendsimportantesnagbigayanabalangnaritoipinabalikaudio-visuallydemocraticdolyarnatigilanmakatulongshenanahimiklumamangwealthplaysnamephysicalforceskumarimotnanakawankinalalagyanaustraliakailanmannagibangreallysimplengnag-angatipagtimplabadstuffedmag-inamagtiisnaglahosingaporebayanfrescomagigitingmatangosinfusionesvitamininaapisumingitdraft,kinuskostalagangcoinbaseaseanmagdadapit-haponisasamadatinghitpapelbilerulammabubuhayiba-ibangdaddymatamanpetsaseenchoitindera