Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

2. Pakain na ako nang dumating ang kaibigan ko.

3. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

4. Nagmadali kaming maglakad papalapit kay Athena at Lucas

5. Maraming iba-ibang kulay na ilaw sa parke.

6. Ang bata ay takot na nakatingin sa kanya.

7. Selamat ulang tahun! - Happy birthday!

8. Kung wala kang pera umalis ka na dyan at baka hindi ako makapagpigil sa iyo.

9. Investing can be a long-term strategy for building wealth and achieving financial goals.

10. Nagsusulat ako ng mga kasunduan at kontrata bilang abugado.

11. This can be a good way to grow your wealth over time, but it also carries risk

12. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

13. Las labradoras son conocidas por su energía y su amor por el agua.

14. "Ang oras ay ginto" ay isang bukambibig na nagpapahiwatig ng halaga ng paggamit ng oras nang maayos at wasto.

15. Magkano ang bili mo sa iyong cellphone?

16. Sumasakit na naman ang aking ngipin.

17. In the early days, telephones were connected to a central switchboard, which connected calls manually

18. Ito ho ba ang pinauupahang bahay?

19. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

20. Tumulo ang laway niya nang malaman na may magandang balita siyang natanggap.

21. Hinanap niya si Pinang.

22. La creatividad es clave para el éxito en el mundo del arte y el diseño.

23. Naramdam ng pagkaawa si Mang Kandoy kaya't agad niyang binato ng isang piraso ng matigas na kahoy ang tigre upang malihis ang atensyon nito sa usa.

24. The director shouted "break a leg!" as we went onstage.

25. Ano ang ginawa niya pagkatapos ng giyera?

26. A quien madruga, Dios le ayuda. - The early bird catches the worm.

27. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

28. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

29. Ang bagong linis na kurtina ay nagbigay ng sariwang at mabangong hangin sa silid.

30. Magandang Gabi!

31. Nasa gitna ng kagubatan kaya hindi mo maiiwasang humalinghing nang malalim.

32. They clean the house on weekends.

33. No dejes para mañana lo que puedas hacer hoy.

34. Gaano kabilis darating ang pakete ko?

35. Saan kami kumakain ng mami at siopao?

36. Gusto ko pang mag-order ng kanin.

37. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

38. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

39. Nag-aapuhap siya ng dispensa mula sa simbahan para sa kanyang mga nagawang kasalanan.

40. Mathematics is an essential subject for understanding and solving problems in many fields.

41. Hugis katawan ng nakahigang babae ang bundok makiling.

42. Hindi niya naiilagan ang dagok ni Ogor.

43. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

44. Saan niya pinapagulong ang kamias?

45. Argh. Parang batang bading naman eh. Anubayan.

46. Ang amoy ng sariwang ligo ay nagbibigay ng mabangong pakiramdam sa buong araw.

47. Kulay pula ang libro ni Juan.

48. Claro, estaré allí a las 5 p.m.

49. Party ni Lory? nabigla sya sakin sa sinabi ko.

50. Sa kasalukuyan, marami ang may agam-agam sa kalagayan ng ating bansa sa gitna ng pandemya.

Similar Words

popularize

Recent Searches

populartiningnansumagottinderaumigibsafebahagingdamdaminmisapanayblusadustpaninvestinghinanakitakofeellarongdaanhighesthahatolpepeautomaticnakatapatfatheryeheysertumiranasisiyahanbarriersfeedback,inalokmawalainisgraduallylalargabilihinkadalagahangtonghumahanganasabibulalaspaghalakhakgearnovellesnaiyakmusicalesasinchildrengospelbingonoblenapatawagnakaluhodpinatirahabitnaiiritangplaceweddinghitsuraasiaestadosiloilodilawkuryentehinampasfianakagawianmiyerkulespigilanhandaanbobotiniobundoknanalotinapaykasaganaannaiilaganpaketeganunvictoriacuandoearnpwedengrememberedmaitimlayuninpumayaggracenakauslingnaaksidentesikipbilerasulhiningislavemarchhmmmmparagraphstextobulaksciencenakaangatnagngangalangmangingisdangnapabayaanimpormagkasabaysuriinpagongika-50pahabolconsumesumasakaymagandangjanepagpapautangkaybilispaglingonplaysditonakatindigmapapavigtigsteshowsbentangsahodkabarkadapanataggabikasalanantsinamagtanghalianinirapanmagkanonaritodenmangangalakaltignanfloorpaparusahannaabotforståschoolsmakakasahodnapatulalavedvarendepalamutimaipantawid-gutommillionsamplianamungabinangganatitiyaktumatanglawmahiyananunuripinunittillexhaustedreadingisasamadaladalaubounconventionaldisplacementmagseloselvisnilutoherundernagingmananalotinitindamapadaliatensyontamadinfectiouspinag-usapanfacemaskkamandagbinilingsundaemakabalikmulighederspeechinvolvepositiboprocesomagbubungaalapaapadverselyutak-biyauniquemagpapabunotpinalayastanimnagkalapitcontinuememobituincontinued