Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "popular"

1. A latte is a popular espresso-based drink that is made with steamed milk.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

5. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

6. Coffee is a popular beverage consumed by millions of people worldwide.

7. Coffee shops and cafes have become popular gathering places for people to socialize and work.

8. El arte callejero es una forma popular de arte urbano.

9. El autorretrato es un género popular en la pintura.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. El Día de San Valentín es una festividad muy popular en muchos países.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

14. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

15. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

16. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

17. Football is a popular sport for both men and women, with many professional women's leagues around the world.

18. Football is a popular team sport that is played all over the world.

19. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

20. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

21. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

26. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

27. Instagram is a popular social media platform that allows users to share photos and videos.

28. La música en vivo es una forma popular de entretenimiento.

29. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

30. Las compras en línea son una forma popular de adquirir bienes y servicios.

31. Lazada's mobile app is popular among customers, with over 70 million downloads.

32. Los blogs y los vlogs son una forma popular de compartir información en línea.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

35. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

36. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

37. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

38. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

39. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

40. TikTok has become a popular platform for influencers and content creators to build their audience.

41. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

42. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

2. The momentum of the economy slowed down due to a global recession.

3. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

4. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

5. I have finished my homework.

6. The athlete completed a series of intense workouts to prepare for the competition.

7. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

8. Nais sana kitang isama subalit hindi talaga maari ang mga kagaya ninyo sa aming kaharian.

9. Kings may have ceremonial duties, such as opening parliament or receiving foreign dignitaries.

10. Siya nama'y maglalabing-anim na.

11. Naupo siya sa sofa at inilagay yung bitbit niya sa mesa.

12. Morgenstund hat Gold im Mund.

13. Dogs can develop strong bonds with their owners and become an important part of the family.

14. At være ærlig over for os selv og andre er vigtigt for en sund samvittighed.

15. May natagpuan umanong bagong ebidensya sa kaso ng pagkawala ng bata.

16. Sa aming mga paglalakbay sa malalayong lugar, natutuwa kami sa mga disenyong mayabong ng mga hardin at parke.

17. Hindi ko maaaring payagan ang aking mga agam-agam na hadlangan ang aking mga pangarap.

18. Tinapos ko ang isang season sa netflix kaya napuyat ako.

19. Nagsimula ang kanilang kwento sa isang takipsilim.

20. The exchange of rings is a common tradition in many weddings.

21. Pinaliguan ng malamig na tubig ang bata na may bungang-araw.

22. A lot of money was donated to the charity, making a significant impact.

23. Kailangan nating magplano upang mas mapadali ang pag-abot ng ating mga pangarap.

24. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

25. Magandang umaga po. ani Maico.

26. Naging espesyal ang gabi ng pamamamanhikan dahil sa pagtutulungan ng dalawang pamilya para sa nalalapit na kasal.

27. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

28. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

29. Kabilang na roon sina Lala, Dada at Sasa.

30. Hinabol kami ng aso kanina.

31. They have sold their house.

32. Matagal na napako ang kanyang tingin kay Kano, ang sumunod sa kanya.

33. Aling lugar sa lungsod mo ang matao?

34. Ang trahedyang naganap sa kanilang komunidad ay nagdulot ng pangmatagalang lungkot sa kanilang mga puso.

35. Narinig ng mga diyosa ang kayabangan ng bata.

36. Les patients peuvent avoir besoin de soins psychologiques pendant leur hospitalisation.

37. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

38. Higupin mo nang dahan-dahan para hindi ka mabulunan.

39. Ang mga bata na nakakaranas ng abuso ay nangangailangan ng tulong at suporta mula sa mga otoridad at mga kasamahan sa komunidad.

40. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

41. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

42. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

43. Selain sholat, orang Indonesia juga melakukan doa melalui upacara adat dan keagamaan.

44. Padabog akong umupo habang dumadating na yung order nya.

45. Ayaw niya ng maarteng palabas kaya lagi siyang nakatago sa kanyang kwarto.

46. Hindi ko makalimutan ang mga sandaling kasama kita. Crush kita talaga noon.

47. Nakakatakot ang paniki sa gabi.

48. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

49. Up above the world so high,

50. Las hojas de lechuga son una buena opción para una ensalada fresca.

Similar Words

popularize

Recent Searches

murangpopularborntulangmunaclientsmedyocultureserhvervslivethumigalalopagkabiglabinibiyayaannakakatawajudicialsiratransitbutobrancher,sugatpaghangauntimelydisentesumusunodcellphonesinundangparusatobaccoandrespamagatlivesadangdayssemillasbridepamasahepiratareaksiyoninfluencesbumabahanaabotadecuadopapalapitmabuhaypapagalitaneclipxesinundomapakaliputoltaosnamumulamakainmakakakaenfireworkspangungutyaalapaapdreamsbansanilinismediumpatpatbroughtpapuntalarryspecializedsignmagkakaroonseparationencountersundaedahilalokincitamenterscalelumusobstevemataaspageproperlymalakingannaumiisodpapayamakaratingbecomingninongpassionhumingamagulanghiramtamapagka-diwatasinunggabanpakilagayanimougatstudentssalitangnakabaonpisaranauliniganmisteryodumagundongearnbumahakapatidlungsodhablabaduranteadgangestadosulitpinapakingganngamalapitsilaleadingbecamenuonrelievedcommunicationcoachingt-isamasarapmalapitancreatingtusongbaduyo-onlinepeppyundeniablefeelgearpaghalakhakmitigatesulatbasastatepinagpatuloydennetresbooksmatabangmadurasvideos,bangladeshbeautyninanakatuwaangkapangyarihangsasamadininasirainaabutanakmangkainanmagpakaramiangkanlosshapag-kainankawayanpinauwimagdamaginangiintayinpitongsistemailangvirksomheder,livecaraballoinnovationbalediktoryantakesmaibabalikdiaperbroadmagsabihugismag-amadonenasasabihanpasantumatakbomenosmalabonaglalarodevicesgaanonaghihikabtingingalamidbillpaggawabumuhoscomunicanpalayointensidadangkopmaulit