Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "armed"

1. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

Random Sentences

1. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

2. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

3. Ang pagpapalaganap ng mga konspirasyon at teorya ng kung ano-ano ay nagpapakita ng pagiging bulag sa katotohanan.

4. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

5. Durante su carrera, Miguel Ángel trabajó para varios papas y líderes políticos italianos.

6. Aksidente niyang nasira ang kanyang cellphone dahil nahulog ito sa banyo.

7. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

8. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

9. Ang pagsasama ng pamilya ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

10. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

11. Nagluto ako ng adobo para kina Rita.

12. Hindi natinag si Kablan sa loob ng kanyang tindahan.

13. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

14. Buenos días amiga

15. The artist painted a series of landscapes inspired by her travels.

16. Sarado ang eskuwela sa Sabado at Linggo.

17. Ayaw niya sanang ipaalam ito sa iyo dahil ayaw niyang mag-alala at maawa ka sa kanya.

18. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

19. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

20. Anong oras gumigising si Cora?

21. May email address ka ba?

22. Tahimik ang buong baryo sa takipsilim.

23. Las hojas de lechuga son una buena opción para una ensalada fresca.

24. He also believed that martial arts should be used for self-defense and not for violence or aggression

25. Tengo náuseas. (I feel nauseous.)

26. "Dogs are not our whole life, but they make our lives whole."

27. Emphasis can help clarify and reinforce the meaning of a message.

28. El realismo y el impresionismo son estilos populares en la pintura.

29. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

30. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

31. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

32. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

33. AI algorithms are computer programs designed to simulate intelligent behavior.

34. What goes around, comes around.

35. Ate, gusto ko sanang mag-isa.. ok lang ba?

36. Nang maglakad ako sa tabing-dagat, nakakita ako ng mga maliliit na alon na mayabong na puting espuma.

37. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

38. Dahan dahan akong tumango.

39. Regular exercise and playtime are important for a dog's physical and mental well-being.

40. Sasagot na sana ulit ako nang lumabas ng CR si Maico.

41. Ibinigay ko na ang lahat ng makakaya ko upang matulungan ka.

42. Håbet om at finde vores sande formål kan føre til stor personlig opfyldelse.

43. Don't worry, it's just a storm in a teacup - it'll blow over soon.

44. El maíz es un cultivo exigente en nutrientes, por lo que es necesario aplicar abono regularmente

45. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

46. Ang lilim ng kanyang payong ay nagsilbing proteksyon sa kanya mula sa matindi at biglang pag-ulan.

47. Athena. nagulat siya at bigla niyang pinatay yung monitor.

48. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

49. Ang galing nya maglaro ng mobile legends.

50. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

Recent Searches

armedspeechdoonlimitdigitaldisenyongnapapasayapagdukwangiintayinpaglalaitaanhinmagbayadmiyerkolescultivagayunmannanghihinatravelernapapalibutanpanghabambuhaymakahirampamanhikankapatawaransasayawinkinamumuhianmagdoorbellmabihisannapakalusogibinibigaytatagaltatayomorningcourtumiinommasaksihanbalitasasamahanpaglakitumagalh-hoymagagawanapasigawpagkatakotnakayukoestudyantemagpakasalpronouncalllivepromotingeksaytedtopic,lcdordermapapaclearthroughoutataquesmakilingbrideworrymalapitfiguresexpertfinishedpalayansarilingstrategyinisemaillightmgamagtagonanunuksopagkaawarektanggulomarasiganmabatongmateryaleslumayointensidaddispositivoencuestaspaki-ulitpahiramseguridadtumalabmagturonapalitangtv-showsnakikitanggovernmentguitarrakasiyahancanteentungocombatirlas,afternoonpropesoranumangtrentaginawaranpatuyoipaghugaspaninigaspinalalayaskagubatanregulering,masaganangminatamisfactoresopisinasasakayautomatiskpatakbolumutanghouseipinansasahogpromisenauntogbahagyangtsinakonsyertomagtanimnahantadumupoawitanpagbatimaibavaledictoriannagpasamatinanggalkinakainnasunogpakistanhinalungkatikatlongnewsinlovemukainantayhinigitnakatingingbinulongcasaanywheredumaanapoyinterestslookedkagandapanindangdissemaibalikltoaksidentebecamehigh-definitionlumilingonbulakcarmenimagesmakakayainformedtelangsaanmagandadollyahitdinalawcontestmasdanisugaseesantolingidclientsweddingpinyaspentsufferasimaabotvalleysalarinlegislationsinagotklasecoalfarmkalaunanpatuloytangingtabletoyaalisthroattobaccotinderaandresnagrereklamo