Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "transportation"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

3. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

4. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

5. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

6. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

7. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

8. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

9. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

10. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

Random Sentences

1. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

2. Anong pangalan ng lugar na ito?

3. Mahilig ang mga Pinoy sa masasarap na pagkain tulad ng adobo at sinigang.

4. Kung anong puno, siya ang bunga.

5. The beaten eggs are then poured into a heated and greased pan.

6. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

7. Elle adore les films d'horreur.

8. Bagai pinang dibelah dua.

9. Butterfly, baby, well you got it all

10. Paki-basa po ang kuwento para sa akin.

11. Wala yun. Di ko nga naisip na makakatulong. aniya.

12. I know this project is difficult, but we have to keep working hard - no pain, no gain.

13. I'm so sorry. di makaling sabi niya habang nakatitig dun.

14. Humihingal na rin siya, humahagok.

15. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

16. Esta comida está bien condimentada, tiene un buen nivel de picante.

17. The singer's performance was so good that it left the audience feeling euphoric.

18. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

19. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

20. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

21. Unrealistic expectations can contribute to feelings of frustration and disappointment.

22. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

23. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

24. Dogs can provide emotional support and comfort to people with mental health conditions.

25. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

26. The bride and groom usually exchange vows and make promises to each other during the ceremony.

27. A couple of goals scored by the team secured their victory.

28. Ang nakita niya'y pangingimi.

29. Malaki ang kama sa kuwarto ni Olivia.

30. Ang buntot ng saranggola ay mahaba at makulay.

31. Bumibili si Rico ng pantalon sa mall.

32. Saan ka galing? bungad niya agad.

33. Nagwalis ang kababaihan.

34. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

35. He has learned a new language.

36. Lahat ng magagaling na maghahabi ay napakahanga sa kakayanan ni Amba.

37. She has been tutoring students for years.

38. Let's just hope na magwork out itong idea ni Memo.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Emphasis can be used to persuade and influence others.

41. El arte abstracto se centra en las formas, líneas y colores en lugar de representar objetos reales.

42. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

43. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

44. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

45. Itinuturo siya ng mga iyon.

46. Nakahug lang siya sa akin, I can feel him..

47. Ang pagpapahinga ng isip at katawan sa pamamagitan ng meditasyon ay nagdudulot ng isang matiwasay na kalagayan.

48. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

49. Habang daan, samantalang patungo sa pamilihang-bayan ng Tondo, ay mataman niyang iniisip ang mga bagay na kanyang pamimilhin.

50. The company's CEO announced plans to acquire more assets in the coming years.

Recent Searches

transportationmaramotfilipinabalik-tanawnatutuwamatapobrengkasangkapanmakinangnakatuonhoteleskwelahannakangisingpinakamatapatactorkalabawfarmnasasakupancourtmamayapinabayaanpartspaliparinpulakinatvspagbigyantwitchbiocombustibleshinahaplosdevicesmaarigovernorscongrats1929sikoratetig-bebentebentahankaharianinnovationheartbeatamountkanilabaghindeinfinitynawalanglendingsagasaanabrilnatutulogviewspebrerokangitansunud-sunodnabigkasrespektivenagtakanamumulamournedpasalamatanfititinuturohangaringcreationchickenpoxnasundobeforenagpalutonagniningningminervienaguusapbandachambersnaglabasquatternabigyanpinatutunayanpaldabringparehasmatipunodahillinggoeasierpinalakingideaioscurrentnaglokohansafepangitmisusedumabogumarawburdenanydecreasealinstudentbinabalikexpandedkaarawanlarawanshineskanyamagsunogstoplighttinderananghihinaparangdalawampunahuhumalingpambansangmaliitkaurihinampasonlinetilabreakpag-iwansamantalangiwantinapaybasahinyantumawamagtiwalanagngangalanggospelnuevos10thtumingalasagotadvertisingumulanreturnedinvolvemagisingyakapinmasarapebidensyafilipinocovidtumaliwasbigongmaliksisumasagotpasasalamatattentiontoyslimatikyayaphilosophykamingsolarstevetayothingssteerherramientaeksamsumalamagselosinfluentialmakabawimagsasakaincluirnagtutulunganmbricosduwende00amhatingsiniyasatkainmagdaanitimsiguroentryitemsginisingilinglorenaadditionally,internatarcilamagkasinggandamakemagsusuotunconventionalmagsi-skiingtwoganitosakopsilaitopasensiyanariyansumusunogloria