Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "transportation"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

3. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

4. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

5. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

6. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

7. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

8. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

9. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

10. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

Random Sentences

1. Mga bopols! Tape lang hindi nyo pa nagawang makabili!

2. Siya ang aking kaulayaw sa lahat ng bagay.

3. Mahilig siya sa pagluluto, datapwat madalas ay hindi niya nasusunod ang tamang recipe.

4. You need to pull yourself together and face the reality of the situation.

5. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

6. She has made a lot of progress.

7. Regular exercise and playtime are important for a dog's physical and mental well-being.

8. This has led to a rise in remote work and a shift towards a more flexible, digital economy

9. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

10. The chef is cooking in the restaurant kitchen.

11. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

12. Nagpasama ang matanda sa bahay-bahay.

13. Las hojas de los árboles proporcionan sombra y protección contra el sol.

14. Tapos nag lakad na siya papunta sa may kotse.

15. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

16. The weather today is absolutely perfect for a picnic.

17. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

18. Sa gitna ng pagdidilim, napansin ko ang nagliliwanag na ilaw mula sa aking bahay.

19. Dadalo si Trina sa workshop sa Oktubre

20. Anong bago?

21. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

22. We need to optimize our website for mobile devices to improve user experience.

23. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

24. Nakukulili na ang kanyang tainga.

25. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

26. Di na ako magtataka dahil alam ko naman ang nangyari.

27. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

28. Congress is divided into two chambers: the Senate and the House of Representatives

29. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

30. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

31. Nagpaluto ako ng spaghetti kay Maria.

32. Nagsusulat ako ng mga kasunduan at kontrata bilang abugado.

33. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

34. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

35. Tila wala siyang naririnig.

36. Masamang droga ay iwasan.

37. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

38. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

39. Itinuturo siya ng mga iyon.

40. Sadyang nagulat ako sa kanyang biglaang pagbisita.

41. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

42. Mahalaga na magkaroon tayo ng mga pangarap upang maabot natin ang ating mga layunin.

43. Saan nyo balak mag honeymoon?

44. Hindi ko maipaliwanag ang aking agam-agam sa magiging resulta ng aking pagsusulit.

45. The basketball court is divided into two halves, with each team playing offense and defense alternately.

46. Después de la lluvia, el sol sale y el cielo se ve más claro.

47. Nariyan sa kahon ang kamiseta mo.

48. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

49. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

50. Doa juga bisa dijadikan sarana untuk memohon kesembuhan dan keberkahan atas orang yang sakit.

Recent Searches

transportationtabanahuhumalingtandangkastilangnamanghakinagatpositibovictoriataga-nayonpaaralanpagbigyannagyayangintelligencesulatpag-asashiningdiyankoronanagbiyayaperfectendeligmag-galavaccinesbahatatawaganaffectimpitpag-alagamanunulatgappagkakamalipagpapakaindrewkampeongurokinabubuhaypumupuntaburgerworkdaymagigingmarvinpulitikotataykaybilisgjortlibangansugatankamag-anakarayzoominiintaymalakingmaingatmagdidiskobahalabayaningfridaylumutanghahalegendaryheilookedpananglawnanggigimalmalnaglabadabirthdayinagawmaatimtumawaggusting-gustolibropagkaawamagpa-paskolugawpatitumalabayudanothingmatulunginenglandplantarbiocombustiblesilihimgandakababayannag-eehersisyokusinanakapaglaromimosakarapatangbumalikmagbibiyahekasamamakawalakasangkapanmagbasareferstamarawgloriapakiramdamsaadsagasaanplanmusicalisasabadlandslidepinapakainmaglutoipongipinagbabawalmatapanglangisprosesomapuputimagbabagsikhanapbuhaykamiwalispatingmaramotumakyatrizalmalayonggreenhillspinagsanglaannag-aabangsakalinglaylayhawlapaghahabifigurasbawatboholpahirapansacrificemahalneverbarrococulturalpagkakalutonamasyalnamanrevisebarabaslansanganlaptopsinopaananhumahangoskawalanayawmisyunerongnagkakakainguiltyfriendsdrawingnapakamotsadyang,pabigatmagkanobeautifulnakitulogipinalitliigdeterminasyonkalagayanpalagingnagpalitmaglalarotibigmississippimahahawatagiliranfredpagnanasajohnmaibalorysalatmaidresearchnaghilamosspansclipkaharianmalungkotmagsasakaaabsentsheunattendedpanitikanvirksomheder,asahansumusunosandokrepresentativetuparinnakatayopakealam