Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "transportation"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

3. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

4. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

5. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

6. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

7. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

8. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

9. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

10. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

Random Sentences

1. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

2. She has been learning French for six months.

3. His presidency was marked by controversy and a polarizing political climate.

4. Nagbago ang anyo ng bata.

5. Ang tula na isinulat niya ay ukol kay Romeo na matalik niyang kaibigan.

6. The host introduced us to his wife, a beautiful lady with a charming personality.

7. At blive kvinde handler også om at finde sin egen stil og identitet.

8. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

9. Ibinigay ng mga magulang ko ang lahat ng kanilang sakripisyo upang maibigay ang magandang buhay sa amin.

10. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

11. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

12. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

13. Masyadong maaga ang alis ng bus.

14. He admired her for her intelligence and quick wit.

15. Danmark er kendt for at eksportere højteknologiske produkter og services til andre lande.

16. Sa kaibuturan ng aking pagkatao, alam kong gusto ko ng katahimikan.

17. Mahalagang maglaan ng sapat na oras sa pag-aaral upang magtagumpay sa buhay, samakatuwid.

18. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng insomnia o hindi makatulog sa gabi.

19. Elektronik er en vigtig del af vores moderne livsstil.

20. The website's search function is very effective, making it easy to find the information you need.

21. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

22. Sino ang kinukuha ng mga sundalo?

23. Have you been to the new restaurant in town?

24. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

25. Nakukulili na ang kanyang tainga.

26. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

27. Mayroong konsyerto sa plasa mamayang gabi.

28. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

29. Ang pag-iwas sa mga diskusyon at pagtatangkang itago ang mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

30. Limitations can be self-imposed or imposed by others.

31. Galing sa brainly ang isinagot ko sa asignatura.

32. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

33. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

34. Magsisine kami sa makalawa ng hapon.

35. Les mathématiques sont une discipline essentielle pour la science.

36. Sa langkay na iyon ay kilalang-kilala niya ang anyo ni Ogor.

37. Humihingal at nakangangang napapikit siya.

38. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

39. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

42. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

43. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

44. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

45. Ang laki ng gagamba.

46. Paano po pumunta sa Greenhills branch?

47. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

48. Nang malamang hindi ako makakapunta sa pangarap kong bakasyon, naglabas ako ng malalim na himutok.

49. Kumaripas ng takbo ang aso nang makita ang paparating na sasakyan.

50. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

Recent Searches

transportationlalongdeterioratepalagiadangtreskalakingmalakibutchelectinteligenteshapagnarininguniqueeverynasundotinigilandoonoverviewobstaclestakecomunessagingresultlupagreatmakapasanaawakaniyamatatagbituinstringshiftformatcuandohighestcontrollednakatagopangnangpaladpitosalapiinalagaanhinanakitpagtataasnochelandligaligtawananhampaslupabotantesamfundmatapangsagabalmatatalinomataraykumaripasprogramming,magkasamaknightactionmapapadaratingtrueredcigaretteincitamenterwaitprogramminghapasinipinalutoguiltyenvironmentnagpalalimnag-away-awaynabalitaannakaramdamnakapagngangalitkinakitaankadalaskategori,magpakasalinsektongnakayukokare-karenagawangpagkapasokpangangatawanambisyosangnakakalayotitabayawakkalalaronagpakunotabundantenakahugnag-uwiumakbaymagdoorbellkagipitanhatinggabicaraballogustongpulgadavegasnatalobarcelonawestnakapapasongkulisapreboundrektanggulomanahimikpumilikontratamakauwimalalakinaglaoncoincidencemahalnapansinnahigitankagubatanfulfillmentmariabobonaglabaattorneyroofstockumiwasempresasnag-eehersisyoeneropocakasalminamasdanmatikmannatulakcompletamentepagkaingkayasinisinanaogwidelymatulisorganizeinvitationkuwebakahusayandasalkakaroonharap-harapangpag-iwannakikitangvehiclesmaskifameeverythingprobablementetagalogxixvelstandmulighederpasalamatanmaitimbernardomabilispinyausashopeeilangnaulinigantugidatapuwadontdeathelectionsjacetryghedsumamanuonsubjectsinundangstudentlangsumalaschedulemamieasierdesdekaragatan,kaparehabalitangpambatangnagpatulongmanggabutilnagyayanghigitrabe