Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

83 sentences found for "world"

1. Acts of kindness, no matter how small, contribute to a more charitable world.

2. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

3. All these years, I have been working to make a positive impact on the world.

4. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

5. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

6. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

7. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

8. Climate change is one of the most significant environmental challenges facing the world today.

9. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

10. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

11. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

12. Einstein's legacy continues to inspire scientists and thinkers around the world.

13. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

14. Football is a popular sport for both men and women, with many professional women's leagues around the world.

15. Football is a popular team sport that is played all over the world.

16. From there it spread to different other countries of the world

17. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

18. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

19. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

20. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

21. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

22. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

23. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

24. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

25. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

26. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

27. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

28. Lee's influence on the martial arts world is undeniable

29. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

30. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

31. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

32. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

33. Mathematics can be used to model real-world situations and make predictions.

34. Mathematics is an essential tool for understanding and shaping the world around us.

35. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

36. Musk has been described as a visionary and a disruptor in the business world.

37. Musk has been named one of the most influential people in the world by TIME magazine.

38. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

39. Nationalism has played a significant role in many historical events, including the two World Wars.

40. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

41. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

42. Not only that; but as the population of the world increases, the need for energy will also increase

43. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

44. Other parts of the world like Burma and Cuba also cultivated tobacco

45. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

46. Remember that the most important thing is to get your ideas and message out to the world

47. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

48. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

49. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

50. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

51. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

52. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

53. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

54. Television is a medium that has become a staple in most households around the world

55. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

56. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

57. The ad might say "free," but there's no such thing as a free lunch in the business world.

58. The amount of knowledge that exists in the world is immeasurable.

59. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

60. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

61. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

62. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

63. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

64. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

65. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

66. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

67. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

68. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

69. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

70. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

71. The United States has been involved in many international conflicts, including World War I and World War II.

72. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

73. The United States is the third-largest country in the world by land area and the third most populous country in the world.

74. The United States is the world's largest economy and a global economic superpower.

75. There are a lot of amazing destinations to explore around the world.

76. There?s a world out there that we should see

77. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

78. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

79. Today, Amazon is one of the world's largest online retailers.

80. Today, Bruce Lee's legacy continues to be felt around the world

81. Up above the world so high

82. Up above the world so high,

83. Women make up roughly half of the world's population.

Random Sentences

1. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

2. "Love me, love my dog."

3. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

4. At være transkønnet kan påvirke en persons mentale sundhed og kan føre til depression, angst og andre psykiske udfordringer.

5. Sebagai tanda rasa terima kasih, orang tua bayi akan memberikan hadiah atau makanan khas kepada para tamu yang hadir.

6. Les écoles offrent des programmes pour aider les étudiants à se préparer aux examens d'entrée à l'université.

7. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

8. Guarda las semillas para plantar el próximo año

9. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

10. She prepares breakfast for the family.

11. Amazon's customer service is known for being responsive and helpful.

12. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

13. Maingay ang bagong taon sa Pilipinas.

14. Naantig ang maawaing damdamin ng mahal na Ada.

15. Mga guro sina G. Santos at Gng. Cruz.

16. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

17. Hindi dapat natin kalimutan ang ating mga responsibilidad, datapapwat ay may mga pagkakataon na napapabayaan natin ito.

18. Palayo na nang palayo ang tunog ng kampana habang umuusad ang gabi.

19. Napakaganda ng disenyo ng kubyertos sa restaurant na ito.

20. Jeg er helt forelsket i hende. (I'm completely in love with her.)

21.

22. Napangiti ako bigla. Yun lang ba yung problema niya?

23. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

24. Tahimik na nanangis si Aling Rosa at laking pagsisisi dahil tumalab ang kanyang sinabi sa anak.

25. A lot of money was donated to the charity, making a significant impact.

26. Sweet foods are often associated with desserts, such as cakes and pastries.

27. Bestfriend! impit na tili ni Mica habang palapit sa akin.

28. The surface of the football field can vary, but it is typically made of grass or artificial turf.

29. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

30. May bago ka na namang cellphone.

31. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

32. Ako ay nagtatanim ng mga puno ng niyog sa aming lupang sakahan.

33. Después de estudiar el examen, estoy segura de que lo haré bien.

34. Isang Pinoy ang nanalo sa international singing competition.

35. Baka puwedeng hiramin ko ang iyong mga gamit pang-kemikal para sa eksperimento.

36. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

37. Ano ang gagawin ni Trina sa Disyembre?

38. Ate, gusto ko sanang mag-isa.. ok lang ba?

39. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

40. Nagsasama-sama ang mga Pinoy tuwing Pasko para magdiwang.

41. Pinapagulong ko sa asukal ang kamias.

42. Saglit lang lang naging kami. Sabi niya sa akin..

43. Ang pagbibigay ng oras at pag-aalaga sa mga alagang hayop ay nakagagamot sa aking kalooban at nagbibigay ng pagmamahal.

44. Hindi ko mapakali ang aking sarili dahil sa aking mga agam-agam tungkol sa aming kasal.

45. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

46. Ibig sabihin, nagpepeke pekean ka lang ng luha kanina?!

47. No puedo creer que ya te vas, cuídate mucho y no te olvides de nosotros.

48. Controla las plagas y enfermedades

49. Nahahalinhan ng takot at lungkot nang kumulog at kumidlat.

50. Ohne Fleiß kein Preis.

Recent Searches

worldmahahanaytabaslangitnalasingdahonpabalingatsumangcometandangangcurrentcuandodulocontrolledbackinaapipackagingamountumarawcreatingsimplengonlythoughtsbeforenaliligogustongnag-away-awayformasharapleftyangnyonababasamahinahongyorkinalagaankasopublicitydescargarabutankanilactricasnilalangpagkatikimmasasalubongarbejdsstyrkenapakagandauponpinagsulatalbularyonagandahanmovieskanginaeksempelengkantadamawalapitoipapainitadditionally,dentistahinanapumalisgamotgulanglandoibinalitangwinspinagpatuloyhinilaintroducepagtutoltrackpataywatchingrolecorrectingnapilingitspressbeyondlorenapambahayfuncionarsupilinnagpapasasabumotokasintahanmakikipag-duetokristoberkeleynegosyantematipunomantikabagkusmassachusettsdumaramiilalagaywaringlabiscontrolahmmmpakistanpasigawmasipagroofstocknanaymatutulogstocksintensidadisamakalongmatangumpaykayabuwandiagnoseskerblagaslasisinalangkalalakihanparatingtapatuuwieeeehhhhcrazyhimcultivationinuminfamilybaldeclearmedya-agwahabangoffermaghilamoskagabihidingkatienakisakayimbescosechasbumabalotentrebilinfiancetekstnatalowellipinadakiptargetsisteroperatepossiblengayonglcddiliginnotebookpointhurtigerepulanagaganapmagbagong-anyoingayaroundbecomesnapakahusaybinawiannagsagawalupamaglarosasapakinkonggawainglansanganenduringnasapangkatcarbonmanilaaddictionsakimganaathenalaryngitiswalngpatunayanpangingimihoneymoonneedslendnakatindigulaminterviewingmedicinebangatemparaturapasasalamatrelonaapektuhanmaingat