Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "never"

1. "A barking dog never bites."

2. "Dogs never lie about love."

3. For you never shut your eye

4. I finally finished my degree at age 40 - better late than never!

5. I finally quit smoking after 30 years - better late than never.

6. I forgot your birthday, but here's a card anyway. Better late than never, right?

7. I have never been to Asia.

8. I have never eaten sushi.

9. I just got around to watching that movie - better late than never.

10. I know I should have apologized sooner, but better late than never, right?

11. I know I should have gone to the dentist sooner, but better late than never.

12. I know I should have started studying earlier, but better late than never, right?

13. I know I'm late, but better late than never, right?

14. If you keep beating around the bush, we'll never get anywhere.

15. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

16. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

17. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

18. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

19. Más vale tarde que nunca. - Better late than never.

20. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

21. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

22. We didn't start saving for retirement until our 40s, but better late than never.

23. We should have painted the house last year, but better late than never.

Random Sentences

1. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

2. "Mahirap magtiis, pero mas mahirap ang walang tiis" ay isang bukambibig na nagpapahiwatig ng halaga ng pagtitiis sa mga pagsubok at paghihirap sa buhay.

3. Natapos ko ang malaking proyekto na matagal ko nang inaayos kaya masayang-masaya ako ngayon.

4. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

5. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

6. Buti na lang medyo nagiislow down na yung heart rate ko.

7. Gaano ko kadalas dapat inumin ang gamot?

8. Si Dr. John ay isang doktor sa kanilang baryo.

9. He was warned not to burn bridges with his current company before accepting a new job offer.

10. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

11. They ride their bikes in the park.

12. Nagtanim ng puno ang mga boluntaryo nang limahan.

13. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

14. The company decided to avoid the risky venture and focus on safer options.

15. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

16. Sebagai bagian dari perayaan kelahiran, orang Indonesia sering mengadakan acara syukuran atau kenduri.

17. El cultivo de frutas tropicales como el plátano y la piña es común en países cálidos.

18. Det er også vigtigt at varme op før træning og afkøle efter træning for at reducere risikoen for skader.

19. El discurso del político está llamando la atención de los votantes.

20. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

21. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

22. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. Eksporterer Danmark mere end det importerer?

25. Las labradoras son muy activas y necesitan mucho ejercicio diario.

26. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

27. Ang pagtutulungan ng mga lokal na pamahalaan at mga grupo sa komunidad ay mahalaga sa pagtugon sa problema ng paggamit ng droga.

28. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

29. L'argent est un élément essentiel de notre vie quotidienne.

30. Bigla nya akong binato ng unan, H-hoy! Magtigil ka nga!

31. Naglalakad ako sa kalsada nang bigla akong napagod sa hatinggabi.

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

34. Puwede bang makausap si Maria?

35. Pagkatapos ng isang daang metro kumanan ka.

36. Lumiwanag ang lansangan dahil sa bagong ilaw trapiko.

37. Ako ay nagtatanim ng mga halaman sa aking bakuran.

38. Bumili siya ng dalawang singsing.

39. Piece of cake

40. Aksidente niyang nasira ang kanyang cellphone dahil nahulog ito sa banyo.

41. Ibinigay ng titser ang libro sa estudyante.

42. Ang pag-asa ay isang mahalagang emosyon na nagbibigay ng lakas at inspirasyon sa mga tao.

43. Television has a rich history, and its impact on society is far-reaching and complex

44. Ang pagkakaroon ng mapagkakatiwalaang kaibigan ay siyang ikinagagalak ni Carla.

45. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

46. Many people think they can write a book, but good writers are not a dime a dozen.

47. Facebook Marketplace is a platform where users can buy and sell items locally.

48. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

49. Nasarapan ako sa luto ni Chef Josh.

50. Magdamag kong naiwang bukas ang ilaw.

Recent Searches

andyneverferrerconectantruechefconstitutionmarkedeachtiniklingweddingtutoringspreadalammarchsakalingganidcontent:daddykriskaabimalamangnatutulogincidenceearlynaubos19291970shuliutak-biyanaglalatangmagkakaroonnewspapersmakisigmakapangyarihangpapanhiklumiwanagopgaver,nakatirafotostumawagkapangyarihangnakaka-inmagpaliwanagkagandahagmagkaibiganpaki-translatecassandranag-aalanganbarung-barongikinasasabiknagbakasyonmagtatagalpagkalungkotadvertising,tinutopparehongmagtataasmumuntingpinakidalanaliwanaganmagsi-skiingdiscipliner,kapasyahanbusinessesnaiyakliv,balediktoryannai-dialmaanghangjejumauupohayaangsinusuklalyanpagtatanimprodujoinilistapamasahehumalomagpagupitmalulungkotpiyanobinge-watchingteknologinabiawangtinatanongkainitanganapinsakyankilayautomatisknakainomtuktoktutusinmagsisimulakuripotbusytawasumimangotlasajennykunehorolandmadalingrememberedmanilanandiyankulisapumibigtanawaregladodiseasesadvertisinghuertohinukaypalitanpayapangandreadyosagawanaglulusakginoongumisiptirangakmangairplanespangingimimatagumpayaminmarangyangcolorpeppyskyldespagputiinatake1950swasaklaruaniigibmalapitanmagnifysilyadangerousreguleringbansanginomtshirthumblebingbingchoiinantaybumabahaasthmaibinalitangdalagangmagtipidritwalasulinilalabasmaisadverseipinadalaelitecentermagdalayascontent,grinssuccessfulbitiwanlandomakaratingmaduraspulahumanosumalibeintespendingsumasaliw1973bilismightpakelamlasingerobienpageotrasbuwalhabangbulsaexpectationssutilinterpretingdonebadluisfigurespalayanshockharmful