Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "never"

1. "A barking dog never bites."

2. "Dogs never lie about love."

3. For you never shut your eye

4. I finally finished my degree at age 40 - better late than never!

5. I finally quit smoking after 30 years - better late than never.

6. I forgot your birthday, but here's a card anyway. Better late than never, right?

7. I have never been to Asia.

8. I have never eaten sushi.

9. I just got around to watching that movie - better late than never.

10. I know I should have apologized sooner, but better late than never, right?

11. I know I should have gone to the dentist sooner, but better late than never.

12. I know I should have started studying earlier, but better late than never, right?

13. I know I'm late, but better late than never, right?

14. If you keep beating around the bush, we'll never get anywhere.

15. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

16. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

17. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

18. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

19. Más vale tarde que nunca. - Better late than never.

20. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

21. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

22. We didn't start saving for retirement until our 40s, but better late than never.

23. We should have painted the house last year, but better late than never.

Random Sentences

1. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

2. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

3. Ok. Alam mo, isa pa yung excited na magka-apo eh.

4. It's not worth getting worked up over - it's just a storm in a teacup.

5. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

6. Nalaman ni Bereti na madalas sumala sa oras sina Karing.

7. Mahilig siyang mag-ehersisyo at kumain ng masustansya, samakatuwid, malakas ang kanyang pangangatawan.

8. Naglalaway siya sa bango ng kape na inilabas ng coffee shop.

9. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

10. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

11. Bumili kami ng isang piling ng saging.

12. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

13. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

14. Jodie at Robin ang pangalan nila.

15. No hay palabras suficientes para agradecer tu amor y apoyo.

16. The amount of knowledge that exists in the world is immeasurable.

17. Naulinigan ng makapangyarihang Ada himutok ng Buto.

18. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

19. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

20. Pupunta kami sa Cebu sa Sabado.

21. Nous allons avoir un photographe professionnel pour immortaliser notre mariage.

22. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

23. Minsan, nagkakaroon ng agam-agam sa isip ng mga magulang kapag nag-aalala sila sa kinabukasan ng kanilang mga anak.

24. Ang pagkakaroon ng malakas na lindol ay binulabog ang mga gusali at nagdulot ng takot sa mga tao.

25. Nagkasakit ka dahil sa kakulangan sa tulog? Kung gayon, kailangan mong magpahinga nang maayos.

26. However, there are also concerns about the impact of the telephone on society

27. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

28. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

29. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

30. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

31. Mange steder i Danmark afholdes der påskeoptog og andre offentlige begivenheder i løbet af Holy Week.

32. Bumibili si Consuelo ng T-shirt.

33. The stock market gained momentum after the announcement of the new product.

34. Sino ang bumisita kay Maria?

35. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

36. Tinutulan ng komunidad ang anumang uri ng abuso laban sa mga kababaihan.

37. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

38. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

39. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. Si Datu Duri ay matandang-matanda na.

42. They have been renovating their house for months.

43. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

44. Da Vinci fue un artista renacentista muy importante.

45. Two heads are better than one.

46. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

47. Naglalagay ng bulletin board ang guro sa silid-aralan upang maipakita ang mga gawain ng mga estudyante.

48. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

49. Miguel Ángel es conocido por sus esculturas, pinturas y arquitectura.

50. Emphasis can be used to highlight a person's strengths and abilities.

Recent Searches

neversumigawreahipabibilanggoaplicacionesnami-missknowssiguronagkakatipun-tipondaigdigpagtataposhastasaidbilibtawagloveancestralesitinagoimpactssedentarybagongwalkie-talkiethanksgivingkumalasnaglaoninangatsinapokaccederhimmarkedreservationpropensokanilasulatngadaramdaminmapayapahesusritooverviewmagkanonakitaluhaidolencompassesmakakatakaskagipitanspongebobotsoumuwiyunbabaedonnagtaposindividualitointerpretingsabogkaklaseklimajingjingsundhedspleje,pagsasalitabayaniginugunitaganitonaismataliklayuninnapahingamarinigbakailangnagsunuranliveinakyatniyangiiwanmalayamariangsellingkayonag-aasikasotondomanylibertydoktorbatalatestcarbonmaongeksenae-explainskyldes,nasasalinansinasadyatuminginbridenabanggamalapitbantulotrockmestmahiligexpectationsnatagalantitigilhayopgitarafistsformaamingkamikanobopolsprutasraymondnasisilawbangkatatawaganmatapangimporsusunduinkanya-kanyangressourcerneattorneywaystrajemanakbokabundukangodbyggetalmusalkagandahanmagtanghaliannapagkaibigankaparusahanself-defensecassandramagisingkapatidtahananhubad-baropadabogkasiyahangnapansinnewothersmisteryonagkikitanaramdamestádaddylegendarykarangalandatakondisyonnahintakutanpunong-punoideyagatolmayroondahonfamilygooglebaboypunong-kahoyeasierenergy-coalcommunicationspitongourumigtadhintayinmentalkangkongsystems-diesel-rununannagtitindahinding-hindilolamasayahinmarketinghanonline,sumakayatensyongfatherkaysadosenangbakurankendtpeppypetsaipinakoobra-maestrabulongsangakumunot