Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "never"

1. "A barking dog never bites."

2. "Dogs never lie about love."

3. For you never shut your eye

4. I finally finished my degree at age 40 - better late than never!

5. I finally quit smoking after 30 years - better late than never.

6. I forgot your birthday, but here's a card anyway. Better late than never, right?

7. I have never been to Asia.

8. I have never eaten sushi.

9. I just got around to watching that movie - better late than never.

10. I know I should have apologized sooner, but better late than never, right?

11. I know I should have gone to the dentist sooner, but better late than never.

12. I know I should have started studying earlier, but better late than never, right?

13. I know I'm late, but better late than never, right?

14. If you keep beating around the bush, we'll never get anywhere.

15. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

16. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

17. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

18. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

19. Más vale tarde que nunca. - Better late than never.

20. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

21. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

22. We didn't start saving for retirement until our 40s, but better late than never.

23. We should have painted the house last year, but better late than never.

Random Sentences

1. Ano ho ang ginawa ng mga babae?

2. In some cuisines, omelettes are served as a light lunch or dinner with a side salad.

3. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

4. Sampung minuto na lang bago mag-alas otso.

5. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

6. Bagaimana cara memperbaiki mesin cuci yang rusak? (How to fix a broken washing machine?)

7. The acquired assets have already started to generate revenue for the company.

8. Sa tuwing Undas, bumibisita ang mga pamilya sa sementeryo upang mag-alay ng mga dasal para sa mga yumaong kamag-anak na maaring nasa purgatoryo pa.

9. Sino-sino ang mga inimbita ninyo para manood?

10. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

11. Kagyat na sumagot ang amang nangingitngit, ngunit siya man ay pinagwikaan din ni Aya.

12. Mamaya na lang ako iigib uli.

13. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

14. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

15. Sige, oo na lang tayo kahit sa totoo lang, ang baduy.

16. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

17. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

18. Buksan ang puso at isipan.

19. Gusto kong maging maligaya ka.

20. The doctor prescribed antibiotics to treat the pneumonia.

21. Hinila niya ako papalapit sa kanya.

22. Ako muna sabi, e, giit ni Ogor.

23. Puwedeng pautang, nanakawan kasi ako?

24. Gusto ko ang pansit na niluto mo.

25. Ang sugal ay isang aktibidad na nasa ilalim ng panganib ng pagkakaroon ng adiksyon at mental na kalusugan.

26. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

27. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

28. Ang kamalayan sa kanyang pangalan at nagawa ay naging inspirasyon para sa maraming henerasyon ng mga Pilipino.

29. The website's social media buttons make it easy for users to share content on their social networks.

30. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

31. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

32. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

33. Aalis na ko mamaya papuntang korea.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

36. Nangagsibili kami ng mga damit.

37. Pagkatapos kong ipagbili ito, bibili ako ng pagkain natin.

38. Ang sugal ay maaaring magdulot ng pagsisira sa relasyon at pamilyang pinansyal.

39.

40. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

41. Birthday mo. huh? Pano niya nalaman birthday ko?

42. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

43. Mahabang pangungusap ang isinulat ni Lito sa pisara.

44. Ibinigay niya ang kanyang panahon upang magbigay ng kaunting kasiyahan sa mga taong malungkot.

45. Lebih baik mencegah daripada mengobati.

46. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

47. She has written five books.

48. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

49. There are a lot of reasons why I love living in this city.

50. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

Recent Searches

fullappnevercrossparatingpotentialrelievedtelevisedbaldepangakofeelmesangnasabingsenadornangangalitnasanwalongkinglibrepagsalakaynapapansinnabiawangnakauslingpiyanohinatidmagsimulasadyangtapelayaslaterdrewkuwentopracticadouminomspreadstatehadkulungancompletegitaranamuhaypartconsiderarmeanpartnerdaddynutrientesworrycommunicationsprinsipengoftenconvertingbeyondheftysetspasinghalcommunicateniceactivityextrahonestojosiehiganteperyahanpasyentehawaiiumiimiktuktoktindafriendsartistspadabognatalongpuwedebangkocharismaticbigongskyldespitumpongnagmistulangmagsi-skiingnalugmokmagkaharappumapaligidnalagutaninasikasonakatapatpinahalatanagtuturonagsasagotmarketplacesmagnakawkumbinsihinkapangyarihangmakitanagpapaniwalakagandahagnagtatakbomagpa-picturepinagmamalakimagsasalitanangagsipagkantahankabutihanjuegosbwahahahahahapaghalikbulaklaktinaynaliwanaganmakuhangmedisinabumalikmaligayaisinalaysayakmangbihirabighanimarangalligayaporsakyancrametumindigtinanggalpalantandaannanamanpwestoanumangcosechar,lumindolpagbebentalinteksisentamaghatinggabihinanaphinukaymukhamawalaadvertisingvegasutilizannakakapuntatinapaytatlopatientpalapagrolandampliaabutangasmenplanning,huertoniligawanstoplightpetergenerationssharedinggindoonbitawaninternetaidabsamapinakatuktokiigibdeterminasyonpeppyupuanbrasosumisidkailanhastacareerpa-dayagonalisipnakapuntahmmmmkatedralsinknobleupangbevarepepeinterestsnilangtingtryghedlatestlaboratentodetteloansgreatiskodaangdoggodumiinitlori