Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "baby"

1. Ang aking anak ay madalas manood ng Baby shark sa youtube.

2. Baby fever can affect people of various ages, backgrounds, and genders.

3. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

4. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

5. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

6. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

7. Baby fever is a term often used to describe the intense longing or desire to have a baby.

8. Butterfly, baby, well you got it all

9. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

10. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

11. Gusto naming makita uli si Baby Janna eh. si Maico.

12. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

13. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

14. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

15. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

16. Nagka-bungang-araw si Baby dahil sa sobrang init.

17. Paborito nyang panoorin ang Baby shark sa youtube.

18. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

19. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

20. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

21. The baby is not crying at the moment.

22. The baby is sleeping in the crib.

23. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

24. The feeling of baby fever can be both exciting and frustrating, as individuals may face challenges in fulfilling their desire for a child, such as infertility or other life circumstances.

25. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

26. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

27. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

28. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

Random Sentences

1. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

2. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

3. Matapang si Andres Bonifacio.

4. My boss accused me of cutting corners on the project to finish it faster.

5. Galing sa brainly ang isinagot ko sa asignatura.

6. Bagamat sa Limasawa, Leyte nagdaos ng unang misa, may isang paring Kastilang nagngangalang Padre Novelles ang nakarating sa lalawigan ng Nueva Ecija.

7. The bookshelf was filled with hefty tomes on a wide range of subjects.

8. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

9. Tinanong ng guro kung mayroon kaming mga katanungan ukol sa aralin.

10. Malapit na matapos ang kanyang termino sa pagka senador.

11. Wala naman sa palagay ko.

12. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

13. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

14. Omelettes are a popular choice for those following a low-carb or high-protein diet.

15. Sa gitna ng gulo, pinili niyang mag-iwan ng mga taong hindi naaayon sa kanyang pangarap.

16. Naging tamad ito sa pag-aaral at sa mga gawaing bahay.

17. Elije el lugar adecuado para plantar tu maíz

18. She is not studying right now.

19. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

20. Mahalagang magkaroon ng financial literacy upang malaman kung paano ma-manage ang mga utang.

21. Nagtawanan kaming lahat sa hinirit ni Kenji.

22. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

23. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

24. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

25. Higit kong daramdamin kung ako na itong nagawan ng di mabuti ay sa kanya pa manggagaling ang huling salita.

26. Hindi siya malilimutin dati, ngunit nagbago ito nang siya’y tumanda.

27. Limitations can be addressed through education, advocacy, and policy changes.

28. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

29. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

30. The film director produced a series of short films, experimenting with different styles and genres.

31. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

32. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

33. Ipapainit ko ho ito sa kusinero namin.

34. No choice. Aabsent na lang ako.

35. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

36. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

37. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

38. Lulusog ka kung kakain ka ng maraming gulay.

39.

40. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

41. Magtanim tayo ng kabutihan sa lupa upang anihin natin sa langit.

42. La planificación de comidas y la preparación con anticipación pueden ayudar a mantener una alimentación saludable.

43. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

44. Nous avons choisi une chanson spéciale pour notre première danse.

45. Ano ang gagawin ni Trina sa Disyembre?

46. Det kan være en udfordrende tid at blive voksen og kvinde.

47. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

48. A couple of coworkers joined me for lunch at the cafe.

49. Binili niya ang bulaklak diyan.

50. La música puede ser una carrera lucrativa para algunos músicos.

Similar Words

magka-baby

Recent Searches

nakikiakusinerobabypresidentialindividualhumalakhakkategori,kaloobangtraditionalhimayineducationalemocionantemaibabundokkamakailanbusloannawatawatdespuesmagpaniwalanapagtuunanklasrumdeclaremaidtingkapatawaranbalahiboiyakyumabanglateresulttiempossaritabumibilitabigrewrockbabenagtitiisanumanpresyoboholfatangkaniskonamumulaklakkinatatalungkuangkapangyarihangtsismosapesolatestcasessinknaliligopabulonglaylaylumbaysumakitgumalapasahespecializedinfusionesolivianapuputolumupodaramdaminmaongnanamanmagkamalipositibonapawinangingilidvedvarendefame2001lastingpagkaimpaktokagandalamanpitumpongnawalangpahirambisikletainihandakumukuhacigarettesstuffedlendinginispagpapakalathubad-baroscientificmakapasaglobalphilosopherhayopeducatingdisposalrecibirmagalingnahantadblesscomunespalagikombinationltokambingipagamotnahihiyangmaya-mayaproducts:relolumindolmatagumpaykaragatannagdadasalefficientidea:makingsolidifypangarapbranchfaultmakapilingexhaustedkisapmataabanganunti-untipalayanumalisfuebethmuchincreaserestawrannatupaditinaobnakapaligidhinatidcombinedadaisiplugawlibreyeahwaitgrammarisinalanghumbletumamanagwikanglinggo-linggonatuwaatabolaawamatamanpangalantabingdagatlolotinigdalawindoingcertaingalaanmicaloob-loobtinakasanthoughpinagalitanistasyonpagpapautangsomnaaksidentemagpapalithvordanpakikipagtagponginingisipaanglumutangsangaboycontroversyalinfullreorganizingmisaabundantegalawpagkatmayamankatagangmag-iikasiyamsawahawaknatingalakamaopanghabambuhayfreelancerdali-daling