Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "iniirog"

1. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

2. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

Random Sentences

1. Sa anong materyales gawa ang bag?

2. Ipinahamak sya ng kanyang kaibigan.

3. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

4. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

5. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

6. Ligaya ang pangalan ng nanay ko.

7. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

8. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

9. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

10. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

11. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

12. Si Leah ay kapatid ni Lito.

13. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

14. Hockey is played with two teams of six players each, with one player designated as the goaltender.

15. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

16. Pagkatapos ng magandang ani, ang aming hardin ay hitik sa sariwang gulay at prutas.

17. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

18. May napansin ba kayong mga palantandaan?

19. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

20. Isang araw sa kanyang pamamasyal ay may nakilala siyang isang bagong mukha.

21. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

22. Ang aking Maestra ay napakabait.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. "Manalig ka sa Diyos at hindi ka mapapahamak," ani ng pari sa kanyang sermon.

25. Siya ang nagpatuloy sa pag-aagwador.

26. Cutting corners might save time now, but it will cause problems down the line.

27. Ang marahas na paggamit ng teknolohiya, tulad ng cyberbullying, ay dapat itigil at parusahan.

28. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

29. El arte renacentista fue una época de gran florecimiento del arte en Europa.

30. Hindi ko mapigilan ang puso ko na tumibok kapag nakikita kita. Crush kita talaga.

31. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

32. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

33. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

34. Dalawang libong piso ang palda.

35. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

36. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

37. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

38. Nagpatingin ang bata sa albularyo matapos siyang makagat ng aso.

39. Tila hindi niya gusto ang mga sinabi mo.

40. Pakiluto mo nga ng pancit ang mga bata.

41. I know I should have started studying earlier, but better late than never, right?

42. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

43. Nakatanggap si Nicolas ng sulat galing sa ninanais niyang paaralan, siya ay nakapasa dito.

44. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

45. Tulala lang rin yung daddy niya sa amin.

46. It's important to read food labels to understand ingredients and nutritional information.

47. Inihayag ng mga empleyado ang kanilang mga mungkahi upang mapabuti ang mga proseso sa opisina.

48. Lumipad ang binatang naging kulisap upang hanapin ang babaeng mas maganda pa kaysa sa engkantada.

49. Makikipag-dueto si Maria kay Juan.

50. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

Recent Searches

nagbentaginoongdecreasediniirogdaanvaliosadisposalmaistorboelectedchamberslargerstaplepinakamaartenggodtdepartmentteleviewingdiagnosticbalingnanlilimahidestablishednakapagproposetag-arawrememberedpasigawasuleyecarriesalitaptapsizeoperativosjunjunsulinganglobalbadingcharmingmaalogpunsopumulottumunogmatakawathenamaihaharapmagdilimdilimsaranggolapatrickminutosasapakinandamingorugavelfungerendenegativeeitherdustpannangangalognagpakunotnabuhaydecreasemanilbihanitakngpuntainformedkakutisklasengnagwaginunokuripotdreamssinghalparticipatingmaaringxviitagaliosprogramming,exitmahihirapnagdaosautomationinterviewingvotesputingprogress11pmmangelumabasnapapahintolabing-siyamtipidisaacinteractmagpaliwanagknowledgepagpasensyahanoutlinemagpa-checkupkirbyfindlasingalexandernamingevolvedjoshuaworkingsatisfactionenforcingsyncdasalfeedbackminu-minutopilingdumilimmanatililumalakicesharingablesulyapbinilingnaglokohanpag-aaniespigasjenayunkomunikasyontumatawakasamaanideyamagsasakawatawatpag-aaralangangalplanhumabolreloinfluencesdatimagpapaligoyligoydyipnikuliglignagyayangkaugnayanspindlebillngayodumarayomakakakaenpopcornfuncionarbranchesmanakbomagpapigiltulongmaalikabokmagdalaexigentepupuntapagpapautangpaldabutchpatawarinano-anopanghihiyangstreetlearneconomypagtawalaki-lakimissiontumatakbolamesasimbahanpamanhikanmagtanghaliandiinvivaareasleemagbabagsikkalansumasaliwgulangcompartenkrusnaghubadbehaviormagsunognakapikitmagpapabunotmakidalotransport,pagkatumabothundredexpeditedglobeaktibistaipinagbabawalpandidirikagipitan