Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "parts"

1. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

2. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

3. Other parts of the world like Burma and Cuba also cultivated tobacco

Random Sentences

1. May nanganganib na mawalan ng trabaho dahil sa aksidente na nangyari sa paggawa ng proyekto.

2. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

3. Women's rights movements have fought for gender equality and greater opportunities for women.

4. Pendidikan agama merupakan bagian integral dalam kurikulum pendidikan di Indonesia, memungkinkan generasi muda untuk memahami dan menghargai agama-agama yang berbeda.

5. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

6. Kailangan ng maraming niyog upang makagawa ng malaking tasa ng pulotgata.

7. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng insomnia o hindi makatulog sa gabi.

8. Nagtatanim siya ng mga gulay at nanghuhuli ng mga hayop sa gubat upang kanilang pagkain

9. I love the combination of rich chocolate cake and creamy frosting.

10. Ang panaghoy ng mga hayop sa gubat ay bunga ng pagkawasak ng kanilang tirahan.

11. Les riches dépensent souvent leur argent de manière extravagante.

12. Isang linggo nang makati ho ang balat ko.

13. Bakit hindi kasya ang bestida?

14. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

15. The acquired assets have already started to generate revenue for the company.

16. Ano ang gusto mo, sinigang o adobo?

17. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. Mabuti na lang at hindi ako nauntog sa bubong ng dyip.

20. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

21. Revise and edit: After you have a complete draft, it's important to go back and revise your work

22. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

23. He has been working on the computer for hours.

24. Magaganda ang resort sa pansol.

25. No hay palabras suficientes para agradecer tu amor y apoyo.

26. Marami ang pumupunta sa Boracay tuwing

27.

28. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

29. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

30. Sila ay nagsisilbing modelo ng katapangan, katapatan, at pagmamahal sa bayan.

31. Hindi ko ho kayo sinasadya.

32. Facebook Events feature allows users to create, share, and RSVP to events.

33. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

34. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

35. Nagbago nang lahat sa'yo oh.

36. Ang tagtuyot ay nagdulot ng krisis sa agrikultura sa buong rehiyon.

37. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

38. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

39. Maaf, saya terlambat. - Sorry, I'm late.

40. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

41. Sa kanyang bakasyon, nagpasya siyang lumibot sa iba't ibang tourist spots ng bansa.

42. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

43. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

44. The website's online store has a great selection of products at affordable prices.

45. Ang ganda ng sapatos ni Junjun.

46. No puedo preocuparme por lo que pueda pasar en el futuro, solo puedo confiar en que "que sera, sera."

47. Puwedeng dalhin ng kaibigan ko ang radyo.

48. Ang kasal ay isa sa pinakamahalagang okasyon sa buhay ng isang tao.

49. El graffiti en la pared está llamando la atención de la policía.

50. To break the ice at a party, I like to start a game or activity that everyone can participate in.

Recent Searches

partsmagdamagannatinagpakukuluannationalgawainmahahawaunanaguasana-allnauntogbinawiannag-poutpalamutitondovariedadnakapagusapsignyeygaanobinigaysoccer1940ditomemoitaktryghedinspiredlackgoingeach4thherramientagayunpamanpagngitimagsalitakapintasangisasabadnavigationtotoosanapaglingontasaituturosikmurainangleadingcelulareswarieskuwelaheartbreakcalciumbilugangdevelopexcusekablannakakaanimchoicestaplelawsrefersdamitwithoutfatalmessagenakakunot-noongobserverermaaaringsadyangsportsmakikipag-duetonakakapamasyalaffiliateinaminlilikonanlilisikpaglakitatawagpagsumamomarurumiactualidadpumitassinasadyaipinauutangnalugodpaghuhugasmagbibiladtinawagdiyaryopisarasakenkalaromasaholpresencemaghapongnapadpadpagsusulitngipingumakyatnapadaanmalasutlanagcurvejodiesinampalmansanasiconscompositorestambayannyanasabingpiecesnilulonblusangmotionwidespreadmulmisusednahulifeltmobileumilingdollaripinabalikmasipagbigyanmagkasintahannabalitaanpagkakatumbanaiyakmamanhikanpakialamnaglahomamahalinhiganteharapantanghaliinilabassahigvegasbarcelonaorganizeexperience,jennyindustryaudiencebilivehiclesmaismerrykumaripasginangrosacigarettepookproducirtinutopresponsiblepdaauthornakakitatreatssiniyasatkatawanghumalakhakpagbigyannagagamitnag-aagawannabubuhaymasaktanvidtstraktnatabunantinahakpapayapakibigyantelebisyongawaingkailandumilatbasketballpesonakapagproposehinanapanihinparurusahankasalanansumingitbarabasnizamericanparehasmachinestulalaganakinseokaywidelydiyospolospecialrailways