Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "writing,"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Emphasis can be used to provide clarity and direction in writing.

3. He has been writing a novel for six months.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

6. I am writing a letter to my friend.

7. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

8. Nanalo siya sa song-writing contest.

9. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

10. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

11. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

12. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

13. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

14. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Ang buhawi ay isang malakas at mapaminsalang bagyo na karaniwang nagdudulot ng malakas na hangin, pag-ulan, at pagbaha.

2. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

3. Bago lumaban sa kompetisyon, sinisigurado niyang isagawa ang kanyang ritwal ng pagmumuni-muni upang mapanatag ang sarili.

4. Higupin mo nang dahan-dahan para hindi ka mabulunan.

5. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

6. All these years, I have been grateful for the journey and excited for what the future holds.

7. Wag mo naman hayaang mawala siya sakin.

8. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

9. They have been watching a movie for two hours.

10. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

11. Si Gng. Cruz ay isang guro sa asignaturang Filipino.

12. Ano ang gagawin mo sa Linggo?

13. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

14. Ang kagandahan ng sunset sa beach ay animo'y pagpapahinga para sa kaluluwa.

15. Hindi ko alam kung paano ito tingnan, kaya sa ganang iyo, ano ang tunay na halaga ng pera?

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. En casa de herrero, cuchillo de palo.

18. Ang pagbibingi-bingihan sa mga argumento at ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

19. The officer issued a traffic ticket for speeding.

20. The app has also become a platform for discovering new music, with songs going viral through TikTok.

21. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

22. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

23. Maraming paaralan at kalsada ang binigyan ng pangalan ni Mabini sa buong bansa.

24. Natutuhan ng mga mag-aaral ang talambuhay ni Lapu-Lapu bilang isang bayaning lumaban sa dayuhang mananakop.

25. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

26. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

27. Bakit ganyan buhok mo?

28. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

29. No hay que buscarle cinco patas al gato.

30. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

31. Nag-aaral si Maya sa Unibersidad ng Pilipinas.

32. She has learned to play the guitar.

33. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

34. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

35. Ang pagdidilim ng aking paningin ay nagpahiwatig ng pagdating ng masamang panahon.

36. Weddings are typically celebrated with family and friends.

37. Nous avons choisi une chanson spéciale pour notre première danse.

38. Det er vigtigt at huske heltenes bedrifter og lære af dem.

39. Pinagpalaluan ng bayan ang kanilang mayor dahil sa kanyang mga proyekto at serbisyo publiko.

40. He admires his friend's musical talent and creativity.

41. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

42. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

43. He's always the first one in the office because he believes in the early bird gets the worm.

44.

45. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkasira ng mga personal na relasyon.

46. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

47.

48. Like a diamond in the sky.

49. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

50. Isang kakaibang ritwal ang nakita nila sa kagubatan kung saan nagsayaw ang mga tao sa ilalim ng buwan.

Recent Searches

kasamaangwriting,pinapakinggankendihelenamanalotinitindaathenaphilippinesacrificepshomelettenakacasaprotestabituinseenuniquedatisatisfactionbillmapadaligumawasagasaannapapatungoalikabukintungawkabundukansharmainetaga-ochandopagsahodiiwasanbirthdayngipingmakilalaitinaasmagtanimmanonoodnilalangcompletamentenasuklampinagkasundomaongproudnaiinitansumasakitpresyoyataiconicmangingisdasantowalisjerry00aminalalayanyescoinbasepublishingmonetizingbathalawindowbroadcomputerkapilingformsexamplenakakatawahinagud-hagodfotostumawagpapagalitanpaglalaitmakipag-barkadamatarayinvesting:nagpepekerevolutioneretcultivaenchantednaguguluhanpansamantalamahahalikmedikalkubyertosnovembertabingreboundhunitaonagbibirohouseholdbrancher,nagbentamilyongsamantalangpagmasdannatatanawmatangkadkanayangkulisapmabutituvosumingitginaganoontulangpakealamhinigitkwebailocoslapitankaysalaomgharingtoretemetrotextoayudaactingtuwidcommunicationsaminnanggigimalmaldarkhadstopsteercontrolaikinagagalakkumembut-kembotmagbibiyahemagbayadnakaka-innapapasayacrucialculturalnagpabotunattendedpamasaheitinatapatadgangnasasalinanpagkuwanisinuottungkodtinuturomagalitniyoggawaingnanigashinugotmissionroselleiyonbalotsalarinparizooseasiteprimerpowerfistsmichaelhitgeneratebinabamuchbackaddinggratificante,nageenglishnagtrabahonakalilipasgobernadornagbigayhitsurananlilisiktatlumpungnapasigawlangkaynamilipitlumakasnapapahintopamilyalumuwasmadungisnungmagkasabaymaulinigannakasakitnailigtasupontumigilengkantadangtindatumawatinderaisusuotiyamotnalugod