Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "humalo"

1. Agad na natuyo ang dugo hanggang sa naging abo ito at humalo sa lupa.

Random Sentences

1. The basketball court is divided into two halves, with each team playing offense and defense alternately.

2. Sa gitna ng tagtuyot, ang mga magsasaka ay nagiigib mula sa ilog para sa kanilang mga pananim.

3.

4. Sino-sino ang mga inimbita ninyo para manood?

5. Tumagal ng tatlong oras ang kanyang operasyon.

6. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

7. Athena ang aga aga nakasimangot ka na kaagad.

8. The wedding photographer captures important moments and memories from the wedding day.

9. Tila malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

10. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

11. Dumalaw si Ana noong isang buwan.

12. La conciencia puede hacernos sentir culpables cuando hacemos algo que sabemos que está mal.

13. Paano ho ako pupunta sa palengke?

14. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

15. Money can be used for both needs and wants, and balancing these priorities is important for financial success.

16. Hindi pa rin siya lumilingon.

17. Mathematics is an essential tool for understanding and shaping the world around us.

18. Gusto ko sanang makabili ng bahay.

19. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

20. Unti-unting lumapad yung ngiti niya.

21. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

22. The cough syrup helped to alleviate the symptoms of pneumonia.

23. Esta comida está bien condimentada, tiene un buen nivel de picante.

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

26. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

27. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

28. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

29. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

30. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

31. Ang tagtuyot ay nagdulot ng malawakang pagkamatay ng mga alagang hayop.

32. She missed several days of work due to pneumonia and needed to rest at home.

33. Bagay na bagay sayo ang suot mong damit.

34. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

35. They do not forget to turn off the lights.

36. Nagising na si Angelica matapos syang operahan sa loob ng limang oras.

37. Walang pagtutol sa mga mata ng mga ito.

38. Wala ho akong kinukuha sa inyong pitaka.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Ang bayanihan ay isang tradisyonal na gawain kung saan ang mga taga-komunidad ay nagtutulungan para sa isang layunin.

41. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

42. I'm going through a lot of stress at work, but I'm just trying to hang in there.

43. Hinawakan niya iyon sa magkabilang tirante.

44. Si Juan ay nadukot ang cellphone dahil sa isang magnanakaw sa kalsada.

45. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

46. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

47. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

48. Ano ho ang masasabi ninyo, Senador Santos?

49. Makinig ka na lang.

50. Over-emphasis can be counterproductive and may undermine the intended message.

Recent Searches

bangladeshinvestshopeehumaloinilagayinilabasinformedinfinityibinigayautomaticibinentapakakatandaanibibigayhinampaskwartonanlakiamuyinnamulatconstitutionmismokontrakinahuhumalingankilongsumusulathagdanannapilitangmayabanggumisingguerrerocigarettesgandahanfreedomsflamencofactoreseskuwelaeksport,dumatingbigaydumaramidisposaldecreasedaratingprusisyonbulalasdalagangpanayumiimikisasabadmakitaabundantepinasalamatantanghaliananapotaenamusicalesniyonpartnernakakarinigattractiveotrascuidado,canteennagbabakasyonarturomakuhalumiwanagipagbilitalagayamandipangcreationdagat-dagatancontent,completecoinbasepasyaofficemalabolumindolpakisabipanogownbumisitagigisingrelievedpondocommunicationsgrandinanasmagkapatidbumabababiyayangtagtuyotbinilingnahulogbinilhanbinatangbinanggachangedbilanginbibilhinbibigyanfiverrbenefitsbelievedbecomingbangkangbaclaranapelyidoadvancesydelseryakapinmanyvideos,tatlumpungpetsanatanggapkumaliwanagpapakainmeetlaryngitisumilingquarantineumakbayumiinitnagagamitumaalistenerpaytumindigmanilbihanminamasdanturismoprosesomartianinalismakukulaysuotpatunayangjortlalargamagsungitreadtumigiltoretegumantiexpertiselinepumuntaarguetumawaglockdowndulalabormanilatumangotumamistumalontumalimtumalabtumahantulisangitnatrabahotowardstatagaltonightnakakalayotiyakanmaliwanagnapaplastikantitigiltangkatinungonutsflighttelefontarcilatanimantanawinsynligesusunodsurveyssupilinsumuwaycharmingsumugodapollosumabogstatingstartedsinunodscienceschoolssanggolroselleangelakatagarosariopnilit