Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "america"

1. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

2. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

3. Politics in America refers to the political system and processes that take place in the United States of America

4. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

5. The website's analytics show that the majority of its users are located in North America.

6. Tobacco was first discovered in America

7. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Ang pasya nang pagkapanalo ay sa tela ng matanda.

2. Nahawakan ko ang katawan ko, Umabot ba kami hanggang dun?

3. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

4. Pumupunta ako sa Negros tuwing Abril.

5. No me gusta el picante, ¿tienes algo más suave?

6. Eksport af fødevarer fra Danmark er en vigtig del af landets økonomi.

7. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

8. Batang-bata ako nalalaman ko 'to.

9. The project is taking longer than expected, but let's hang in there and finish it.

10. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

11. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

12. Debemos enfrentar la realidad y no ignorarla.

13. Agad niya itong kinuha at isinaboy sa paligid ng salamangkera.

14. The team lost their momentum after a player got injured.

15. Me duele la espalda. (My back hurts.)

16. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

17. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

18. Napakabuti nyang kaibigan.

19. El acceso al agua potable es un derecho humano fundamental.

20. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

21. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

22. Hindi mo alam kung maarte siya o hindi dahil hindi siya masyadong nakikihalubilo sa ibang tao.

23. Ang Ibong Adarna ay tungkol sa isang mahiwagang ibon na nakakapagpagaling sa sinuman na makakapagkuwento ng totoong pangyayari.

24. Give someone the benefit of the doubt

25. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

26.

27. The candidate who wins the most electoral votes becomes the President

28. She is cooking dinner for us.

29. He set up a charitable trust to support young entrepreneurs.

30. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

31. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

32. El error en la presentación está llamando la atención del público.

33. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

34. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

35. Marami sa atin ang nababago ang pangarap sa buhay dahil sa mga karanasan.

36. TikTok has faced controversy over its data privacy policies and potential security risks.

37. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

38. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Las redes sociales son una parte fundamental de la cultura digital actual.

41. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

42. Gusto ko na magpagupit ng buhok.

43. Malayo ho ba ang estasyon ng tren?

44. Saya sayang dengan keindahan alam di Indonesia. (I love the natural beauty of Indonesia.)

45. Good morning din. walang ganang sagot ko.

46. Si Aguinaldo ay kinikilala bilang isa sa mga pinakamahalagang bayani ng Pilipinas.

47. Lahat ng magagaling na maghahabi ay napakahanga sa kakayanan ni Amba.

48. Maraming tao ang nagpapanggap na bukas palad upang makuha ang gusto nila, kaya kailangan nating maging maingat.

49. Ang taong hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

50. Kumaripas ng lakad ang matanda nang bumilis ang ulan.

Similar Words

American

Recent Searches

americapaghalikmakauwihawaiimaibibigayrektanggulojuegosnakahugsugatangginagawapinansinnationalvedvarendenahigitantinuturoevolucionadoparkehabitssakalingsukatinnawalasumalakaynakauslingnabasalever,mayroongambagsapatdasallayawracialestilosiyakejecutannag-replysaramulighederlipaddikyamdisposalmagigitinglistahanhomepumulottransmitidasgoodeveningcelularesintereststwo-partydinanashaypasalamatanumaagoslonghalikamapapaproblemaconectanmalapitintroducesaringdaaninilalabasroughincreasetechnologicalcheffigurecommunicaterelievedextranegativekatutuboprogramareturnedcomunicarsewaitabledoingmemorymakapilingberkeleyhanapbuhaynaawanabalitaanmagbayadnakangisinakuhamabagalincludingcollectionsmarinigmasaksihanconocidoshalinglingkatagalaninakyatmatindingisinasamaconsistpalibhasakalawakankamustadinadasalhealthkabuhayannagniningningrewardingnakapagreklamobabaerosedentarystatingtabingbecomesdinukotmasukolpartsschoolsmasinopglobalisasyonsinagotestasyonnakakarinigbandangbansangkamakailanbabaengpinakamalapitleadingtaassumayawmalakihotelnamatayweddingbalitangmakakakainnakabluebandanapabalitakadaratingumaganasundodingdingnasasaktanmakakataloisinisigawlaptopmakakawawanapadaannasasabingmakakayaguhitbluemasayangdosenangmariemartatmicamatandang-matandanakakapamasyalnapadpadalamidtomorrowpagsigawnasaktancolorsinapakfinishedkonsentrasyonnasawihatinggabisinanararanasanimbeslumakingganitosiempremay-bahaymaghapongnochenapasigawgumagamitmakapangyarihangbalitaipantalopmakatulogsinimulanconditionoffentligmagsusuotdisyembrepakibigaykamalayanganangtusindvisnilapitandireksyonpagtayokurakot