Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "victoria"

1. En el siglo XVII, el Barroco español produjo figuras importantes como Francisco Guerrero y Tomás Luis de Victoria

2. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

Random Sentences

1. I'm on a diet, but I couldn't resist having a small slice of cake.

2. Le chien est très mignon.

3. He has been playing video games for hours.

4. Después de una semana de trabajo, estoy deseando que llegue el fin de semana.

5. Nationalism can also lead to authoritarianism and repression of dissent.

6. Hindi ko maintindihan kung bakit kailangan pang magpaplastikan kung maaari naman nating sabihin ang totoo.

7. Kumirot ang dibdib ko sa naisip.

8. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

9. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

10. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

11. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

12. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

13. Oh sige na nga sabi mo eh. hehe.

14. Les enseignants peuvent être amenés à enseigner dans des écoles différentes en fonction de leurs besoins professionnels.

15. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

16. I love the combination of rich chocolate cake and creamy frosting.

17. I admire the perseverance of those who overcome adversity.

18. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

19. El agua potable es fundamental para mantenernos hidratados y saludables.

20. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

21. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

22. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

23. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

24. Nagsisilbi siya bilang pari upang magbigay ng espirituwal na tulong sa kanyang mga parokyano.

25. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

26. Walang makakibo sa mga agwador.

27. Nagsasagot ako ng asignatura gamit ang brainly.

28. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

29. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng positibong pananaw at pagpapakita ng determinasyon.

30. As a lender, you earn interest on the loans you make

31. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

32. The title of king is often inherited through a royal family line.

33. Saan naman? Sa sine o DVD na lang? tanong ko.

34. Isa sa mga paboritong routine ni Carlos Yulo ay ang floor exercise, kung saan madalas siyang mag-uwi ng medalya.

35. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

36. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

37. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

38. El estudiante con el peinado raro está llamando la atención de sus compañeros.

39. Me cuesta respirar. (I have difficulty breathing.)

40. Presley's influence on American culture is undeniable

41. Kakain ako ng spaghetti mamayang gabi.

42. Mahal niya pa rin kaya si Lana?

43. Las heridas superficiales pueden ser tratadas con agua y jabón.

44. Pasensiya na kayo, wala po akong relo.

45. They are not singing a song.

46. Nagluto ng pansit ang nanay niya.

47. Hinawakan niya ito sa isang bisig at sa pagdidilim ng kanyang paningin ay pabalingat niyang pinipilit sa likod.

48. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

49. At sa sobrang gulat di ko napansin.

50. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

Recent Searches

victorianamangmarahanmarangalzamboangasamantalangdiwatangrawdilaggivetv-showsnakuhangtiniklingmanoodenglandturonbayaniabenemaramottuluyangrupoano-anomanalonamumukod-tanginatatanawpakibigyanednamantikakasakitmagalangpagodsumusunodkokakmainitdawhitsurasumasambahanapbuhaypangalanasawapaki-basamansanasalbularyoipinanganaknag-uwingisieksperimenteringmatangkadtumindigbagamatgoodeveningkulangcitizenpetsamailapnangumbidapisaralacsamanadeclaremusicalsahigmataraypinanawandisyempretaga-tungawnakakakuhameronyourlayout,lutomaagalamesapangnangestudyantepriestteachernaglutomabangosomepuwedengmahigitbibilistep-by-steppagkahaponaliligobiyassasamaitinalidisplacementbataypinakamahabakutosangkalanapopalamutibotekonsiyertomatulunginpasyanakaangatpulakolehiyomag-ibaibabacountlesskalabangrocerytamarawganyantanimanpatungopautanglibongpagkatiemposdivisorianapadpadnaglipanamaglalabakulaytumirapisokalaunanpalayanpasadyaarabiamagkababatatinutophandaanlabanannagaganapmatagumpayswimmingebidensyakontingritwal,matatinulungantinikleksiyonkahonsuwailmagtataassinehanpinunitpaghamaknoelnaguusapdireksyonkinikitapakakasalanlabaskawawangpadalaspahabolnapansinkawili-wilisalariniba-ibangcapacidadesmasayahinjobsleftdalagakubyertosworkingkaagadrepublicanmotiontigasoftenlinggonghabasupportnapakamisteryosokayamaipagmamalakingfindmaka-alisprogramayunglegacykikitabarabasyukokaninaukol-kayhvordanmalamiglumuhodpaboritongpangangailanganmalalimtinuturosabihinwaglabing-siyamalismaibalikmakipag-barkada