Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "videos"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. El internet es una fuente de entretenimiento, como videos, juegos y música.

3. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

4. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

5. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

6. Instagram is a popular social media platform that allows users to share photos and videos.

7. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

8. Las redes sociales son una plataforma para compartir fotos y videos.

9. She spends hours scrolling through TikTok, watching funny videos and dance routines.

10. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

13. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

14. TikTok is a social media platform that allows users to create and share short-form videos.

15. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. Sa bawat pagsubok na dumarating, palaging may aral na natututunan.

2. The team’s momentum shifted after a key player scored a goal.

3. Es importante no cosechar demasiado temprano, ya que las frutas aún pueden no estar maduras.

4. Mayroon pa ba kayong gustong sabihin?

5. Let's just hope na magwork out itong idea ni Memo.

6. It's nothing. And you are? baling niya saken.

7. Le jeu est une forme de divertissement dans laquelle on mise de l'argent sur un événement aléatoire.

8. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

9. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

10. Nagpakitang-gilas si Jose sa pamamagitan ng mabilis na pagpasa ng bola.

11. The artist's intricate painting was admired by many.

12. Kapag may isinuksok, may madudukot.

13. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

14. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

15. En España, el cultivo de la vid es muy importante para la producción de vino.

16. They go to the gym every evening.

17. Iba ang landas na kaniyang tinahak.

18. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

19. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

20. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

21. Lahat ng tao, bata man o matanda, lalake at babae, ay tumaba.

22. My grandma called me to wish me a happy birthday.

23. Para poder cosechar la uva a tiempo, debemos empezar con la vendimia en septiembre.

24. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

25. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

26. Ang poot ay isang pusong nasaktan na lumalaban upang mabawi ang dangal at dignidad.

27. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

28. Los bebés pueden nacer en cualquier momento del día o de la noche, y algunas veces pueden llegar antes o después de la fecha prevista.

29. Pumasok ako sa cubicle. Gusto ko muna magisip.

30. Los Angeles, California, is the largest city on the West Coast of the United States.

31. Mahirap mahalin ang isang taong mailap at hindi nagpapakita ng tunay na damdamin.

32. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

33. Napansin ko ang bagong sapatos ni Maria.

34. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

35. Pang-isahang kuwarto ang gusto niya.

36. Ako ay nagtatanim ng mga puno sa aming lugar upang mapanatili ang kalikasan.

37. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

38. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

39. Matagal akong nag stay sa library.

40. Nagpakita sa Datu ang Dakilang Bathala at ipinaalam sa ama na ang kanyang anak ay mabubuhay ng labing-siyam na taon lamang.

41. Las hojas de palmera pueden ser muy grandes y pesadas.

42. Nasa banyo siya nang biglang nabigla sa tunog ng pagbagsak ng isang kahon.

43. Ang sugal ay maaaring magdulot ng labis na stress, pagkabalisa, at pagkabahala sa mga manlalaro.

44. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

45. Nagbigay ng malaking tulong sa akin ang aking guro sa paghahanda sa aking thesis.

46. El autorretrato es un género popular en la pintura.

47. Maraming mga uri ng droga, tulad ng marijuana, cocaine, heroin, at methamphetamine.

48. Pero bigla na lang siyang hindi nagpakita.

49. Me encanta la comida picante.

50. Naglalaro sa isip niya na ngayong napakalakas ng ulan lalo siyang magtataas ng presyo.

Similar Words

videos,

Recent Searches

poorervideosnagtatanongmag-uusapadgangnapakalusogsistemasmateryalesleaderskabutihankumalmatindatelecomunicacionesvidtstraktumangattungopagtatakapatakbocanteenfysik,arkilasumasayawpinipilittinanggalnakarinigdamdaminpabilikabighagarbansos00ampaglayasmenstelephonebahagyangpesobinawiannagpasanpromisepag-itimunoskanilalaganappagsidlansahodrenaiakaraokeantesopportunitynilalangmagdilimmukhaanungpangakoinstitucioneskapalinihandapaslitmaghilamosnagpasalamathabitsurroundingsbaryoexpeditedpaggawapalapagatensyonsisipainpagputibinibilangsumisidathenaimbescarlokarapatannagisingmukadissepaskongmaidjenanuhpadaboggodtlamanglayasleosnatresmeaningipapaputolbagyomasdanreservesstillprimer1980bobodinalawritodemocraticnagreplyhamaknewhalllimosseekbumahaganaantoniomachinestalaclassroomadvancedoncemillionsagosforcesnilutosulingandidingimagingcontinuesclearlcdpinunitsagingbaldeentercomputerecreationresourcesthembeyondcakesidohankasaganaanngisimay-bahayeventscarriedredesthirdtinigmommymemorymanagerheftyinteligentesjunjunaffectgoinghalossomnagtatrabahoabstainingtabiilongmahabolkoreaagilawaaahacernanoodnakabiladkabiyakpublicitybakaayawenduringmagkasakitmalayangsobrakikootherpromotepunsosinapakkarangalangrewsorrytipwatchzooleadbetweenpalitanmagbagong-anyomagpapaligoyligoynakakunot-noongnakaliliyongmagsasalitasponsorships,kumembut-kembotbaranggaymakikiraankinagagalaknagpakitamarketplacesnagpagawa