Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "videos"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. El internet es una fuente de entretenimiento, como videos, juegos y música.

3. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

4. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

5. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

6. Instagram is a popular social media platform that allows users to share photos and videos.

7. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

8. Las redes sociales son una plataforma para compartir fotos y videos.

9. She spends hours scrolling through TikTok, watching funny videos and dance routines.

10. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

13. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

14. TikTok is a social media platform that allows users to create and share short-form videos.

15. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. Nagsisunod ang mga kawal sa palasyo pati ng mga nasasakupan.

2. Oo, malapit na ako.

3. Wag na, magta-taxi na lang ako.

4. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

5. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

6. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

7. Isa sa mga paboritong routine ni Carlos Yulo ay ang floor exercise, kung saan madalas siyang mag-uwi ng medalya.

8. Sige.. pupunta tayo sa Jeju Island next March 26..

9. Ang hinagpis ng buong bansa ay naging lakas upang magkaisa sa harap ng pagsubok.

10. Nais ko lang itanong kung pwede ba kita ligawan, kasi sa tingin ko, ikaw ang gusto kong makasama.

11. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

12. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

13. Hindi niya alam kung anong uri ang halamang iyon.

14. J'ai acheté un nouveau sac à main aujourd'hui.

15. Madalas akong nagbabasa ng libro sa hatinggabi dahil hindi ako makatulog.

16. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

17. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

18. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

19. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

20. All these years, I have been striving to live a life of purpose and meaning.

21. Gusto rin nilang patunayan kung siya nga ay magaling tulad ng napabalita.

22. Me cuesta respirar. (I have difficulty breathing.)

23. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

24. Mas lumakas umano ang ekonomiya matapos buksan muli ang mga negosyo.

25. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

26. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

27. Bumalik siya sa Pilipinas kasama ang suporta ng mga Amerikano noong 1898.

28. Puwede ba siyang pumasok sa klase?

29. Oo. Tatawagan ka daw niya pag nandyan na siya.

30. She has adopted a healthy lifestyle.

31. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

32. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

33. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

34. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

35. Ano ang nasa tapat ng ospital?

36. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. Emphasis can be used to create a sense of drama or suspense.

39. Marahil ay maulan bukas kaya't dapat magdala ng payong.

40. El invierno es una de las cuatro estaciones del año.

41. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

42. Sa muling pagkikita!

43. Ordnung ist das halbe Leben.

44. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

45.

46. Binabarat niya ang mga paninda sa siyudad.

47. Bwisit talaga ang taong yun.

48. Dumating siya mula sa Bikol kahapon ng umaga.

49. Salatin mo ang upuan upang matiyak na tuyo ito bago ka umupo.

50. Tuwing biyernes, ginugol niya ang buong araw sa paglilinis at paglalaba ng bahay.

Similar Words

videos,

Recent Searches

umiisodpakikipaglabanvideosnaglulutoomfattendegownmalawaksementoarabiabibilhinkakayananctricashatinggabiawitinbanalpagsusulitbook,kontrapinalambotmanalogawingmakakasunud-sunodmatutongtanghalimakisuyoniyoneksport,manghuliadvancekahilinganhigh-definitionteachersacrificebuntisedsanogensindepinalayaskasuutanwaiterpusabestidabinibilangsumisilipreynaelenalangkayjoblayuansakimcalidadlihimmariloupinagalitanritocollectionsgabingconsistbuwanginangshopeeblazingsalarindalawamapaibabawalexandertradegrinscelularestilladangtiketmayabangsaykasoasthmaaudienceapoypromotingconsumetracklivepublishingidea:transitvedgameeveningrefersproducirtsaabluedemocraticmarsogreenseektools,jacereducedmasdansumamapostcardbagogitanasmakapilingyeahlutuinjunjunitemscontrolledwaitmaratingbetaconditionedit:debatesappstatinginternaobstaclesschoolnothingtelevisedinilingpartnerteamenforcingpdapaga-alalakagalakanhinipan-hipanmagpa-ospitaltinulak-tulakmakauuwinakaluhodnangampanyanagulatpalipat-lipatbabaetumatanglawpinakidalamahinognakatindigyoutube,kaharianmaipagmamalakingpinamalaginabighanikabundukanimpormagsi-skiingsiniyasatsalemagpaliwanagnasasabihannakalipasnagpepekemakangititatlumpungmilyongcountrytuktoknasaannagbentatumatakbotinungocardigangiyeramakapalkaninonangapatdanmasyadongrichpaghaliknalalabingkolehiyopananglawculturasbalediktoryanmauntogmagbalikmagpasalamatsinusuklalyantawaiyongkaraniwangahhhhmaibabalikcitybibigyanginahawlasumasayawnagsisigawsiguropanatagpananakitkababalaghangjolibeeumulan