Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "1970s"

1. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

2. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

Random Sentences

1. Wag na, magta-taxi na lang ako.

2. Me encanta pasar tiempo con mis amigos jugando al fútbol.

3. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

4. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

5. El proceso de dar a luz requiere fortaleza y valentía por parte de la madre.

6. Napasigaw ang naghihinagpis na ina! Hindi nito maatim ang nakikitang paghihingalo ng mga anak.

7. A bird in the hand is worth two in the bush

8. Si Ana ay humanga sa disenyo ng saranggola ng kanyang kuya.

9. Kapag pumunta ako, may makakawawa.

10. Ang pagbisita sa magagandang tanawin ng Pilipinas ay ikinagagalak ng mga turista.

11. Nasa tabi ng ilog, pinagmamasdan niya ang mga isdang naglalaro sa tubig.

12. Padalas nang padalas ang mga nawawala kaya't lumapit ang taong bayan sa kanilang makisig na hari upang humingi ng tulong.

13. Nanghahapdi at waring nasusunog ang kanyang balat.

14. They are often served with a side of toast, hash browns, or fresh greens.

15. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

16. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

17. Omelettes are a popular choice for those following a low-carb or high-protein diet.

18. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

19. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

20. Not only that; but as the population of the world increases, the need for energy will also increase

21. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

22. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

23. Las hojas de otoño son muy bonitas en la ciudad.

24. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

25. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

26. The stock market can be influenced by global events and news that impact multiple sectors and industries.

27. Ohne Fleiß kein Preis.

28. The momentum of the wave carried the surfer towards the shore.

29. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

30. Baby fever can affect people of various ages, backgrounds, and genders.

31. A father's love and affection can have a significant impact on a child's emotional development and well-being.

32. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

33. Ang tissue ay mabilis higupin ang tubig.

34. May I know your name for networking purposes?

35. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

36. Algunos artistas famosos incluyen a Leonardo da Vinci, Pablo Picasso y Frida Kahlo.

37. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

38. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

39. Maaf, saya tidak bisa datang. - Sorry, I can't come.

40. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

41. Nakita kita sa isang magasin.

42. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

43. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

44. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

45. She has a poor credit history due to late payments and defaults on loans.

46. Sa droga, walang nagwawagi kundi ang tao mismo.

47. D'you know what time it might be?

48. Dahil sa tag-ulan, ang temperatura ng panahon ay kadalasang mas malamig at mas nakakapalamig.

49. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

50. Uuwi kami sa Pilipinas sa Disyembre.

Recent Searches

1970smalilimutanisubolilipadcaraballoandreateachingsunconventionalincrediblectricaspagsidlanrightsmanalonakapikitnapadpadpinisilfavormaluwaghinagiskubonovembertilirobinhoodturonmatalimcandidatesimportantelinaitinulospampagandapaglalabamalawakgloriapalitancurtainslilikobayaningnangingitngittodaskaybilisyamanbumangonnagtagisaninventionlayuanidiomatanawnapadaansumingitmatigasasiaticsacrificetinitindasalitangpanindangmagnifykuwebaunahincaroltugonfiverrwaiterpinatirapromotemaongelenaanghelbaryokurakotbotanteasthmagranadatiniobingopresyoinantaykikopriestmukachoiipinasyangkinainairconpasigawpatayfrescomakahingiresortamerikaagadgrinstillniligawangamitintransmitidaswalapaghingiklasrumtaasgoshneed,casamasokpakelamhigitparagraphskinakaligligconnectingulamritoleosinapakramdampierfuelremainmoderneteleviewingbatokpopularizeayonabrilmaynilaatdedication,provepakpakdumiretsomulalingscientistitakprobablementeso-calledmatindingmaalogbilhinschoolschavitmoodmalagocomienzandalagagenerationerpupuntagraceactingpicsfiguressumalapangulobumugaproducirbinabaanramonmuligreendesdeprosperdontipinikitpetsastageinternetlayuninonetrueauthorlockdownkartonofteislaworldspeedkingofferharmfultabiinalisipasokarmedresourcesdosformabitawanitinuringletstudiedbreakdadabaketutorialsputinglutuintheirstructurewhethertabatipeditortechnological