Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "reorganizing"

1. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

Random Sentences

1. La pièce montée était absolument délicieuse.

2. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

3. O-order na ako. sabi ko sa kanya.

4. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

5. Ang mga sundalo nagsisilbi sa kanilang bansa upang protektahan ang kanilang kalayaan.

6. Ang pagtanggi sa mga ebidensya ay nagpapakita ng pagiging bulag sa katotohanan.

7. Dahil sa aksidente, hindi na nakapagtapos ng pag-aaral ang biktima.

8. Television has also had an impact on education

9. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

10. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

11. Wag mo nga akong lokohin. Sige na.

12. Nakapunta ako sa Bohol at Cebu.

13. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

14. Al elegir un powerbank, es importante considerar la capacidad de la batería, el tamaño y la compatibilidad con los dispositivos que se cargarán.

15. Ang mga nangunguna sa industriya ay kadalasang itinuturing bilang mga eksperto at mga awtoridad sa kanilang larangan.

16. Wag kana magselos, mahal naman kita eh.

17. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

18. Yumao na ang lolo ko dahil sa katandaan.

19. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

20. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

21. Ang magnanakaw ay napag-alamang anak ng isang kilalang kriminal sa lugar.

22. The experience of bungee jumping was both terrifying and euphoric.

23. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

24. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

25. Ang haba na nang bigote mo, mag ahit ka nga!

26. That'll be 4,788.50 pesos ma'am.

27. I always wake up early to study because I know the early bird gets the worm.

28. Ang kagandahan ng sunset sa beach ay animo'y pagpapahinga para sa kaluluwa.

29. Ang malambot na lilim ng ulap ay nagbigay ng kakaibang kulay sa silong ng buwan.

30. Eksport af fødevarer fra Danmark er en vigtig del af landets økonomi.

31. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

32. Ayaw niya sanang ipaalam ito sa iyo dahil ayaw niyang mag-alala at maawa ka sa kanya.

33. Gaano ko kadalas dapat inumin ang gamot?

34. Hindi ko kayang mabuhay ng mayroong agam-agam sa aking buhay.

35. Ang bawa't isa ay may kanya-kanyang ginagawa.

36. Sabi ko sa inyo, halos kumpleto kami kasi wala si Sync.

37. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

38. Børn skal beskyttes mod vold, misbrug og andre former for overgreb.

39. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

40. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

41. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

42. Upang makita niya ang babaing gaganda pa sa sumpa sa kanya, nagdala siya ng ilaw tuwing gabi.

43. Anong tara na?! Hindi pa tapos ang palabas.

44. Keep practicing and hang in there - you'll get better at it.

45. Natutunan ng mga mag-aaral ang talambuhay ni Melchora Aquino bilang isang "Ina ng Himagsikan."

46. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

47. La música que produjo el compositor fue muy innovadora para su época.

48. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

49. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

50. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

Recent Searches

reorganizingalmacenarvictorianapawisinkcuthirapwhilematandangmaskikinagatalesuniversalitinanimsuwailmabutiapollomakasalanangmagpakasalpangyayariunti-untiadikhansubject,mayabayarankutsilyomakainnaawamalaki-lakicommerceseasitehonestosystematisklivekasalukuyangmadenohmaramotkaraniwangwishingsentimoskataganggitnagandahanmagasawangmakasamaputinggumagawanalagutannag-eehersisyotumambadjackylagunakinalimutansuzettegovernorstanggapinyoukamposaferecordedanimoincidencepasalamatantumabaayawlagiayusinmalalimmaawagoodeveningpinaulanansampaguitacarriesyamanbilerbutjuanglumapadpagapangalingdumitienenshetkalikasanbangmasayahinpinauwimalapadbroadalituntuninpatpattmicasagingilagaypagkabatabotobyggetpasinghalkumunotpalibhasakinanagplaysinalilimanakbaliwvariedadfrabenefitsnakiramayrepresentativepangalanansamakatuwidsamakatwidmahahabakayinterestslavedingbumilinagtutulungantuvoencuestascaniginitgitnasirastillplasataingalalabhanrobertbumigaydiferentesdahanfredorderinde-lataetsyililibrebitbitmaiscenterika-12kapemangahaskarwahengenfermedades,sinungalingkaniyagumagamitcharismatickainkungcorrientesnasasakupansanangpaniwalaanusingbalitabinatahvorsumayawngumitilastmagpapakabaitbatokgumalingmakatiyakalexandertransportationkalagayannagdalasumusunodlikasnakakatawasharingpalayoklarrystatusgeneratedsirmulingkalawakanhorseakongpamilihang-bayanmakapag-uwidanskelawaikinatatakotlever,kalupiburolpoliticaltinulak-tulakpangkaraniwangtinikmannapabuntong-hininga