Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "music"

1. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

2. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

3. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

4. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

5. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

6. Einstein was an accomplished violinist and often played music with friends and colleagues.

7. Emphasis is an important component of artistic expression, such as in poetry and music.

8. He listens to music while jogging.

9. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

10. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

11. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

12. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

13. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

14. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

15. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

16. I am listening to music on my headphones.

17. I am not listening to music right now.

18. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

19. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

20. Saya suka musik. - I like music.

21. The app has also become a platform for discovering new music, with songs going viral through TikTok.

22. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

23. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

24. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

25. The music playlist features a variety of genres, from pop to rock.

26. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

27. Today, Presley is widely considered to be one of the most important figures in American music and culture

28. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

29. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

Random Sentences

1. Ang bango ng lupa pagkatapos ng ulan ay nagdala ng mabango at sariwang simoy.

2. Fødslen kan tage lang tid, og det er vigtigt at have tålmodighed og støtte.

3. Hindi ko mapigilan ang puso ko na tumibok kapag nakikita kita. Crush kita talaga.

4. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

5. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

6. Kapag bukas palad ka, mas maraming taong magmamahal at magtitiwala sa iyo.

7. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin sa buhay sa tulong ng pananalig sa Diyos.

8. Have you eaten breakfast yet?

9. La escasez de agua es un desafío global que afecta a muchas regiones del mundo.

10. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

11. Gusto mo ba ng mainit o malamig na kape?

12. Kung wala kang maayos na balak, huwag kang umasa sa magandang resulta.

13. Ang kuripot mo naman, minsan lang ako magpalibre eh.

14. Butterfly, baby, well you got it all

15. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

16. In 1977, at the age of 42, Presley died of a heart attack

17. Dahil sa sipag at determinasyon, nakamit ni Michael ang tagumpay.

18. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

19. Mi amigo es un excelente cocinero y siempre me invita a cenar en su casa.

20. Bibigyan ko ng cake si Roselle.

21.

22. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

23. Muli ay nakabawi ang ekonomiya ng Pilipinas matapos buksan ang turismo sa iba't ibang panig ng bansa.

24. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

25. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

26.

27. Mahalaga ang papel ng mga organisasyon ng anak-pawis sa pagtitiyak ng kanilang mga karapatan.

28. Ang edukasyon lamang ang maipapamana ko sayo.

29. Masyado ka naman nagpapaniwala kay Andrew!

30. I forgot my phone at home and then it started raining. That just added insult to injury.

31. He makes his own coffee in the morning.

32. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

33. Mauupo na lamang siya sa kanyang balde.

34. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

35. El arte puede ser utilizado para transmitir emociones y mensajes.

36. The website has a chatbot feature that allows customers to get immediate assistance.

37. Kailangan ko ng lumisan mahal ko.

38. Ang gusto sana namin ay dalawang double beds.

39. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

40. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

41. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

42. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

43. Ang aso ni Lito ay mataba.

44. Ang pelikula ay ukol kay Jose rizal na lumaban para sa kanyang bayan.

45. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

46. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

47. Saan nagtatrabaho si Roland?

48. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

49. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

50. Aling bisikleta ang gusto niya?

Similar Words

musicalesmusicalmusicianmusicians

Recent Searches

musicdepartmentbakantematumalgumigisingpropesorindustriyaguidewritetabaentryhighestinteractdatabowbringingstudiededit:monetizinginfluenceimprovebitawanmarkedparatingcaracterizamalimulituhodagwadorbarung-baronglaki-lakipagsasalitakatagalpanghihiyanglabing-siyamnakauporevolutioneretkinakabahanmanunulatnagsasagotsong-writingnanlilisiktinangkamagkasintahankagandahaghinipan-hipangayunmanmakikipaglaronamumuongmoviesdahan-dahanprogrammingninanaispumitasumuwimahinamakaraanpagtatanimsinasadyamontrealforskel,magtataasnahintakutanbulaklakgumagamitmangkukulamhomeworkromanticismopinag-aaralanhardinpagnanasakampeontuktokiiwasannakablueinterests,tinungonatabunanpicturesnalugodkinalalagyantahananpinigilansinusuklalyankanluransaan-saankaklasenagagamitnaiinisngunitulitfiverranarolandmisteryodespuesheartbeatkailantmicanovemberbayangpulongmerchandisegulangbutipakibigaypulgadahacertinitindasinunodpalakawhytilanamumutlapinag-usapanmatchingcongratsintroducecadenagreencafeterialabingkaringpookloriorugaultimatelysinapakfakedyanwatchingipinadalamenosjanepalaybinatanggoodeveningmahahaba1787combinedbestcourtmansanasaudiencecompositoreskinainsagaprenatoskyldesklasengpebrerowasakpinatawadmuystep-by-stepsasagotdoonobstaclespinalakingyourmetodedollarareaipinagbilingpdaspaghettioftekartoneveningproducirsumangcomplicatedsumimangottulongbakakayotamarawmagpagalingnakakapasokiwinasiwasbutihingmaglutoo-onlineinilingsiyangvaledictorianailmentscashmoneynapakamotbagomaninirahanlumisanmamimiliganangsigaprocessesmatayumaonandaya