Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "music"

1. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

2. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

3. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

4. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

5. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

6. Einstein was an accomplished violinist and often played music with friends and colleagues.

7. Emphasis is an important component of artistic expression, such as in poetry and music.

8. He listens to music while jogging.

9. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

10. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

11. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

12. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

13. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

14. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

15. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

16. I am listening to music on my headphones.

17. I am not listening to music right now.

18. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

19. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

20. Saya suka musik. - I like music.

21. The app has also become a platform for discovering new music, with songs going viral through TikTok.

22. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

23. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

24. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

25. The music playlist features a variety of genres, from pop to rock.

26. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

27. Today, Presley is widely considered to be one of the most important figures in American music and culture

28. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

29. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

Random Sentences

1. Ang malambot na lilim ng ulap ay nagbigay ng kakaibang kulay sa silong ng buwan.

2. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

3. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

4. Durante el trabajo de parto, las contracciones uterinas se hacen más fuertes y regulares para ayudar al bebé a salir.

5. Det er vigtigt at huske heltenes bedrifter og lære af dem.

6. Beinte pesos ang isang kilo ng saging.

7. The song went viral on TikTok, with millions of users creating their own videos to it.

8. Sa isang iglap siya naman ang napailalim.

9. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

10. Inakyat ng bata ang puno at tinikman ang bunga.

11. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

12. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

13. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

14. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

15. Ang sugal ay naglalayo sa mga tao sa kanilang mga responsibilidad at mga mahahalagang gawain sa buhay.

16. Sa kalikasan, mahalaga ang mga punong-kahoy dahil ito ang nagpapakain sa iba't ibang uri ng hayop at insekto.

17. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

18. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

19. Tila may nagseselos sa bagong kasapi ng grupo.

20. Mga ganid sa kapangyarihan ang ilan sa mga pulitiko.

21. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

22. Sumalakay nga ang mga tulisan.

23. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

24. Mahalaga na magtulungan tayo upang maabot ang ating mga pangarap bilang isang grupo o komunidad.

25. The company burned bridges with its customers by providing poor service and low-quality products.

26. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

27. Ilan ang tao sa silid-aralan?

28. "A barking dog never bites."

29. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

30. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

31. Bukas ang kupasing damit na giris, nakahantad ang laylay at tuyot na dibdib.

32. The website's analytics show that the majority of its users are located in North America.

33. Format your book: Once your book is finalized, it's time to format it for publication

34. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

35. Anong oras mo ako ihahatid sa airport?

36. Malapit na naman ang bagong taon.

37. La planificación de comidas y la preparación con anticipación pueden ayudar a mantener una alimentación saludable.

38. Wives can also play a significant role in raising children and managing household affairs.

39. Umupo kaya kayong dalawa! sabi sa amin ni Kriska

40. Natawa ang bata ngunit pumayag din ito.

41. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

42. Narito ang pagkain mo.

43. Napahinga ako ng malakas kaya napatingin siya sa akin

44. Anong klaseng karne ang ginamit mo?

45. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

46. Guten Abend! - Good evening!

47. Plan ko para sa birthday nya bukas!

48. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

49. Nabalot siya ng kapangyarihan ng abo ni Rodona.

50. Kucing juga dikenal dengan kebiasaan mereka untuk mengasah kuku di tiang atau benda lainnya.

Similar Words

musicalesmusicalmusicianmusicians

Recent Searches

musicimagingnakapamintanasumasaliwinaaminhinimas-himaspedronagpasalamatdapatumaasamamayathoughnagkitabinigyangsumimangotnapakasipagnarooncompanynyosinaadobodogsdiyosangnagkakakainlegendjoenagsimulanagkalapitkondisyongiyeraguidegiveomfattendemanananggalkesomabironeed,humalonakatawagserikinasasabikhelpeddesisyonanwouldfulfillingnagsasagotpagtutolinalalayanburmangunitugalireservesfuepumulottumalimgayunmanginugunitainterests,siguradodaangmamayangnapakagandanakikisaloartistapangalanannawalalihimkanluranharapandraft,bokpaghihingalonatatapospakainnabigkaspagdiriwangflighttag-arawmaranasanranaymagkakapatidipinagbilingiboningaytokyocablehalagausonaskampanasisikatwarisaan-saanrosemagdakagandahanpaki-drawingmayamantapatpumasokgisingbinibinitagtuyotledbinatakanumanseveraltalinonagbibigayanmatamishomekalayaankinaipagmalaakilibrengmagasinyumaokalawakanspindleenergypahirapanipaalamdustpancompartenliv,bulongmamasyalkaunticultivationso-calledmagkasing-edadnailigtasnagmamaktolprogramming,pagkakalutopaaralanmagawangbiyaslaptophapag-kainansharmaineneedlasondoktorblogmayorsutilninaharapmalilimutanpagsisisisolpinag-aaralaninihandasakyanpamamasyalbudoklibreleadklasekulaydisenyodatapwatcramenagsisikainhumanapculturanobodylumisanehehetinamaankabutihankababayannakasimangotrestawrannanonoodbagsakclosejuneplagaskaynandunmaynilaatmangyayaripanitikan,iwinasiwasmaniladapit-haponsumisidkandidatokaarawan,maglalakadbabaidaraantuwang-tuwagalitpinapalonakakagalakatawansapatos