Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "know"

1. "Dogs are better than human beings because they know but do not tell."

2. "The better I get to know men, the more I find myself loving dogs."

3. D'you know what time it might be?

4. Don't beat around the bush with me. I know what you're trying to say.

5. Excuse me, may I know your name please?

6. Hi, we haven't been properly introduced. May I know your name?

7. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

8. I always wake up early to study because I know the early bird gets the worm.

9. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

10. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

11. I don't think we've met before. May I know your name?

12. I don't want to beat around the bush. I need to know the truth.

13. I know I should have apologized sooner, but better late than never, right?

14. I know I should have gone to the dentist sooner, but better late than never.

15. I know I should have started studying earlier, but better late than never, right?

16. I know I'm late, but better late than never, right?

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. I know things are difficult right now, but hang in there - it will get better.

19. I know this project is difficult, but we have to keep working hard - no pain, no gain.

20. I know we're behind schedule, but let's not cut corners on safety.

21. I know you're going through a tough time, but just hang in there - you're not alone.

22. I'm sorry, I didn't see your name tag. May I know your name?

23. It takes one to know one

24. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

25. May I know your name for networking purposes?

26. May I know your name for our records?

27. May I know your name so I can properly address you?

28. May I know your name so we can start off on the right foot?

29. Ngumiti lang sya, I know everything, Reah Rodriguez.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

32. Some people argue that it's better not to know about certain things, since ignorance is bliss.

33. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

34. Sorry, I didn't catch your name. May I know it again?

35. Though I know not what you are

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Ikinagagalak kong malaman na natupad mo na ang iyong mga pangarap.

2. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

3.

4. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

5. Kings may wield absolute or constitutional power depending on their country's system of government.

6. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

7. Hindi maiwasan ang naghihinagpis na damdamin ng mga biktima ng kalamidad.

8. Hindi maganda ang magkaroon ng maraming utang dahil ito ay nagdudulot ng dagdag na gastos at kahirapan sa buhay.

9. Ikinagagalak naming ipaalam na ikaw ang napili para sa posisyon.

10. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

11. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

12. I like how the website has a blog section where users can read about various topics.

13. Marahil ay maulan bukas kaya't dapat magdala ng payong.

14. Magdoorbell ka na.

15. Ilan ang mga puno sa bakuran ninyo?

16. La tos productiva es una tos que produce esputo o flema.

17. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

18. Fødslen kan også være en tid med stor frygt og usikkerhed, især for førstegangsforældre.

19. Naglalaba ako ng mga sapatos pagkatapos ng malakas na pag-ulan para hindi ito maaksididente.

20. Ang pagtanggap ng mga bisita at pagkakaroon ng masayang kasiyahan ay bahagi ng mga tradisyonal na okasyon sa Chinese New Year.

21. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

22. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

23. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

24. The stock market gained momentum after the announcement of the new product.

25. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

26. The officer issued a traffic ticket for speeding.

27. Tumawa rin siya ng malakas, How's Palawan? tanong niya.

28. "The more people I meet, the more I love my dog."

29. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

30. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

31. Kapag hindi tama ang timpla ng pulotgata, maaaring maging mapakla o mapait ito.

32. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

33. Simula noon ang batang si Amba ay naging unang gagamba.

34. Magaling magturo ang aking teacher.

35. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

36. Wala kang dalang payong? Kung gayon, mababasa ka ng ulan.

37. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

38. Paano ka pumupunta sa opisina?

39. Pupunta ako sa Germany sa susunod na taon.

40. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

41. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

42. Isinuot niya ang kamiseta.

43. Está claro que la evidencia respalda esta afirmación.

44. Sa panahon ng kalamidad, mahalaga ang bayanihan upang mapabilis ang pagtulong sa mga nangangailangan.

45. The website's analytics show that the majority of its users are located in North America.

46. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

47. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

48. Nakita ni Juan ang paparating na bus kaya’t kumaripas siya para maabutan ito.

49. Hanggang gumulong ang luha.

50. The mission was labeled as risky, but the team decided to proceed.

Similar Words

knowsknowledgeknow-howknown

Recent Searches

studiedbitawanthoughtsguiltyknowpatrickincludeclientetopiccertainsino-sinorefpinabayaanstorkainanpublishingpaglalayagmagandangkayaerannakakunot-noongmagbagong-anyomagpa-picturegumagalaw-galawmasayananghihinanakapagreklamonagliliyabkinikitahealthierressourcernenagkitanagsusulatcomokapangyarihangpagkakamalinapakahusaypapagalitanisinulatmusicianreserbasyonnakatayonag-iinompangalannagkasakitmakikitulogpambansangmananakawpandidirinaiilaganmahahalikkatuwaanpalancapinakidalapowerpointjobskarunungannagpatuloysalepamamasyalpagkaimpaktobuung-buobloggers,katawangjuangmagpakasalnagmistulangpanghihiyangnagsagawamakidalominu-minutonapakamotinasikasotongmangahasnakahugmensaheawtoritadongseguridadmahinanecesariomaulinigankumakainnasabiarbularyoengkantadangsinusuklalyannagdadasalnapatigilkanginakatutubovidenskabmagsugaleksempelmarketing:francisconangapatdanjingjingmagagamitharapantuktokmahuhulisalaminsilangngisikastilangtsismosamagisiptelebisyonlansangannaliligolumusobbinentahansisikatnaghubadkonsyertopadalasxviihiramniyontalagangpasaheisasamaprovewhiletatlotmicamoneysahodisubolugawumulanhanapinunoslakadkaramdamangrowthpagdamisakaytondotanganisinumpacurtainsdisciplinnababalottigasnaisgalingpangkatnagisingculpritpebrerosalesmaisiptulalarenatokinantapaksalenguajetokyokuyapapelsumingitiniibigcarbonnawalahukaydaladalamedidagamitinnicobawainulitgoodeveningbumabagvisttarcilaeditipinadalaestartinderapagodpangingimifurwalngipapaputolbigoteisinalanglabisbalingulampinaladdisyemprebumahamagpuntabilinseeandamingsabihingako