Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "know"

1. "Dogs are better than human beings because they know but do not tell."

2. "The better I get to know men, the more I find myself loving dogs."

3. D'you know what time it might be?

4. Don't beat around the bush with me. I know what you're trying to say.

5. Excuse me, may I know your name please?

6. Hi, we haven't been properly introduced. May I know your name?

7. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

8. I always wake up early to study because I know the early bird gets the worm.

9. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

10. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

11. I don't think we've met before. May I know your name?

12. I don't want to beat around the bush. I need to know the truth.

13. I know I should have apologized sooner, but better late than never, right?

14. I know I should have gone to the dentist sooner, but better late than never.

15. I know I should have started studying earlier, but better late than never, right?

16. I know I'm late, but better late than never, right?

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. I know things are difficult right now, but hang in there - it will get better.

19. I know this project is difficult, but we have to keep working hard - no pain, no gain.

20. I know we're behind schedule, but let's not cut corners on safety.

21. I know you're going through a tough time, but just hang in there - you're not alone.

22. I'm sorry, I didn't see your name tag. May I know your name?

23. It takes one to know one

24. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

25. May I know your name for networking purposes?

26. May I know your name for our records?

27. May I know your name so I can properly address you?

28. May I know your name so we can start off on the right foot?

29. Ngumiti lang sya, I know everything, Reah Rodriguez.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

32. Some people argue that it's better not to know about certain things, since ignorance is bliss.

33. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

34. Sorry, I didn't catch your name. May I know it again?

35. Though I know not what you are

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

2. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

3. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

4. Sino-sino ang mga kaklase ni Carmen?

5. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

6. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

7. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

8. Einstein's brain was preserved for scientific study after his death in 1955.

9. Napatingin ako sa kanya, Bakit naman?

10. Twinkle, twinkle, little star.

11. Nogle helte er berømte idrætsstjerner.

12. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

13. Agad na ginamot ni Mang Sanas si Nam at nawala ang lahat ng kaniyang mga sakit at sugat.

14. This can include reading other books on the same topic, interviewing experts, or gathering data

15. Marahil ay nasa kabilang dako ng mundo ang taong mahal mo kaya't hindi kayo nagkikita.

16. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

17. Bumibili si Rico ng pantalon sa mall.

18. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

19. He has been writing a novel for six months.

20. Kung mababatid lang ng mga tagaroon ang katotohanan, marahil hindi na sila magtataka kung bakit namumukod-tangi ang kagandahan nina Lala, Dada at Sasa.

21. Format your book: Once your book is finalized, it's time to format it for publication

22. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

23. Limitations can be a result of geographic location or access to resources and opportunities.

24. Emphasis is the act of placing greater importance or focus on something.

25. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

26. Stock market investing carries risks and requires careful research and analysis.

27. Nakikita mo ba si Athena ngayon?

28. Hindi dapat nakatutok tayo sa mga kababawan ng buhay, kundi sa kabutihan ng ating kapwa at ng ating bansa.

29. El equilibrio entre la ingesta de calorías y la actividad física es importante para mantener un peso saludable.

30. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

31. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

32. La ganadería y el cultivo de pastos van de la mano en muchas explotaciones agrícolas.

33. "Laging maging handa sa anumang sakuna," ani ng opisyal ng gobyerno.

34. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

35. Ang paggamit ng droga ay hindi lamang nakakasira ng kalusugan ng isang tao, kundi maaari rin itong magdulot ng epekto sa buong lipunan.

36. Magaganda ang resort sa pansol.

37. Kinuha ko yung CP niya sa bedside table.

38. Setiap individu memiliki hak untuk mengamalkan agamanya sendiri dan menjalankan ibadah sesuai keyakinan masing-masing.

39. Pinakain ni Rose si Mrs. Marchant ng almusal.

40. Eating healthy is an important way to take care of your body and improve your quality of life.

41. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

42. Ang pulis ay nakabalik na sa outpost at sa isang ospital na tumatawag.

43. She joined a charitable club that focuses on helping the elderly.

44. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

45. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

46. Kabilang na dito ang pamilya ni Mang Pedro at Aling Rosa at ang nag-iisa nilang anak na si Ana na siyam taong gulang.

47. Marmaing sandaling walang nangahas magsalita.

48. El Día de San Valentín es una oportunidad para demostrar el amor que sentimos por nuestras parejas.

49. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

50. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

Similar Words

knowsknowledgeknow-howknown

Recent Searches

knowsupilinkirotformasinformationkatipunanperformancekinatatayuannamumulaklaknuevamedyoinalokbulongbairddyipnigulangbutchformapagsasalitapinangnamulakusinakulangmagpa-ospitalmayabongnyaspentrenaiabayantigresaranggolatayopumiliplatorubberguroperangpanalanginnapalakasmaayosinlovepitongunitedstatesmakamitparteidaraanmaliligomaabotbumabapinagpalaluanpinagwikaanpinagsikapanlolaproudmahiyaumuwibobodumapangusokantokawalcovidarmedpinagsabogakongtransparentiponghashotdogtaonghenrymabutimag-alasfederalmediummagdalabahagimaninipisbobmakagawapinagsanglaanamoybumiliumulanbobotopaki-basasumamasinapittumirapumasokisinakripisyoikinalulungkotsampaguitakaawaynanghihinamadkutodnamangdesarrollaronbaku-bakongyou,natuyonapakalakiparusangnakalimutandanskesparecurednamuhaysiyamrizalinfluentialipagtanggolmababasag-ulomakikitulogmababangongkitanakikihalubilocaracterizakutodyiptermhinanakitmiralanabasaalas-tressjoenanangiskitmahiwagangtrinaikinuwentothirddilawbinabanapakaalataplicacionestsinabalitamakapaghilamosnatapakanmasamabumangonnag-umpisamaskaranamissmakapanglamangpag-asatitsernagtawananhamaksadyangjobsalesharapmahabolmatchingpotaenabasahansinundankasiyahangfestivalessugatanmasasarapmaubosclientegumulongpinauupahangalexandernakabasagpupursigisigmapagkalingaernannalungkotjagiyaakalalibrenghahakumilostumalabpagkalipasmakukulayatinumigibnaiyakhanapinmangyayarikakayurinleadingkamaylinggofacemaskdrawingmatulogmasasabipinaladmaunawaan