Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "know"

1. "Dogs are better than human beings because they know but do not tell."

2. "The better I get to know men, the more I find myself loving dogs."

3. D'you know what time it might be?

4. Don't beat around the bush with me. I know what you're trying to say.

5. Excuse me, may I know your name please?

6. Hi, we haven't been properly introduced. May I know your name?

7. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

8. I always wake up early to study because I know the early bird gets the worm.

9. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

10. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

11. I don't think we've met before. May I know your name?

12. I don't want to beat around the bush. I need to know the truth.

13. I know I should have apologized sooner, but better late than never, right?

14. I know I should have gone to the dentist sooner, but better late than never.

15. I know I should have started studying earlier, but better late than never, right?

16. I know I'm late, but better late than never, right?

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. I know things are difficult right now, but hang in there - it will get better.

19. I know this project is difficult, but we have to keep working hard - no pain, no gain.

20. I know we're behind schedule, but let's not cut corners on safety.

21. I know you're going through a tough time, but just hang in there - you're not alone.

22. I'm sorry, I didn't see your name tag. May I know your name?

23. It takes one to know one

24. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

25. May I know your name for networking purposes?

26. May I know your name for our records?

27. May I know your name so I can properly address you?

28. May I know your name so we can start off on the right foot?

29. Ngumiti lang sya, I know everything, Reah Rodriguez.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

32. Some people argue that it's better not to know about certain things, since ignorance is bliss.

33. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

34. Sorry, I didn't catch your name. May I know it again?

35. Though I know not what you are

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Anung email address mo?

2. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

3. I am not exercising at the gym today.

4. Il est tard, je devrais aller me coucher.

5. Ang kalawakan ay punung-puno ng mga bituin.

6. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

7. Football is also known as soccer in some countries, particularly in the United States.

8. Ok. Alam mo, isa pa yung excited na magka-apo eh.

9. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

10. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

11. Mayroong konsyerto sa plasa mamayang gabi.

12. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

13. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

14. Tinuro ng aking lola kung paano magluto ng suman gamit ang pulotgata.

15. Ilan ang telepono sa bahay ninyo?

16. Unti-unting nakakabangon ang ekonomiya ng Pilipinas matapos tanggalin ang lockdown.

17. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

18. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

19. mga yun. Ang mahalaga ay makapagempake ako agad.

20. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

21. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

22. Las serpientes son reptiles que se caracterizan por su cuerpo largo y sin extremidades.

23. Nosotros celebramos la Navidad con toda la familia reunida.

24. Gaano katagal niyang hinintay ang pakete?

25. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

26. They served a mouthwatering strawberry shortcake for dessert.

27. Mi amigo me prestó dinero cuando lo necesitaba y siempre le estaré agradecido.

28. Ang pogi ng BF mo Maria, sana-all!

29. Pumupunta siya sa Maynila bawat buwan.

30. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

31. Malakas ang ulan, datapwat hindi ako makakalabas ngayon.

32. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

33. Yeah. Mabuti na muna siguro yung ganun.

34. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

35. Bahay ho na may dalawang palapag.

36. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

37. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

38. Bakit umiiling ka na naman? May problema ka ba?

39. Pupunta ako sa Madrid sa tag-araw.

40. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

41. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

42. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

43. Maraming alituntunin ang ipinatutupad sa eskwelahan.

44. No hay mal que por bien no venga.

45. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

46. Ku, e, magkano naman ang laman? ang tanong nga babae

47. No tengo palabras para expresar cuánto te agradezco.

48. My best friend and I share the same birthday.

49. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

50. Ang kaaway sa loob ng bahay, ay higit na nakakasakit kaysa kaaway sa labas.

Similar Words

knowsknowledgeknow-howknown

Recent Searches

knownagpapaniwalalamangahitpanggatongkahaponkatagangnangyariechavehalakhakpaki-drawingkasalukuyanghmmmydelserneedsnahawakanpapaanoinaabutanbalik-tanawtinawagnagawangumiisodinuulcermangkukulamromanticismokinagalitanairportenglandkanilakuwartorestaurantglobalrolandkaraokevegasumulankasiiskedyulsusielectoralsakenbagkuscapitaltinungopinisilcongressmariobinatangmahawaanipinadalamaipagmamalakingkontratanagyayangnalangwidefreedomsbornlistahanbutterflymapaibabawnaguguluhanguulaminpalasyoasahansidosinusuklalyanofficeshortinfluencestelevisedbansangkumikinigkaugnayantuktokwaysdalandankabosesplaysmasaholngitinalalaglagnaisgracestaplequalitybairdalayrobertpagkainiswasakeverymauntogstatushitikangkopmakakasahodkahuluganintroducetagtuyotmatipunosinasabitarcilanagnakawfirstbansamagsusuotmagsi-skiingnagpalutostudentsjohnpalaginghehepagkatnaguusapprovidedutilizadecreasedmaatimconectanbugtongsistemasallowedpointnagsilapititemslegendkwebangvelfungerendetakemakakakaenhellomulpaskotumalabtabingproblemakulisapsagappractices11pmaggressionprogressulingpangarapprocesserrors,pagpasensyahanincitamenterdinalafuncioneslasingsobralibagfiguresnangmasnakatuwaangobra-maestranaiwangpagongapoyelopinatutunayancelularesbinibiyayaanailmentsmagdamagpapagupitkabighajuanitonapakamotmultosparematamanparkehallriseagospangakosumayamaskaratumatawagstayna-suwaysongsnakatirangipinambiliinjurytamadbio-gas-developingunconventionaltilianimodadalawinaanhinhinamakcorporationhunyokomunidadisusuot