Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "know"

1. "Dogs are better than human beings because they know but do not tell."

2. "The better I get to know men, the more I find myself loving dogs."

3. D'you know what time it might be?

4. Don't beat around the bush with me. I know what you're trying to say.

5. Excuse me, may I know your name please?

6. Hi, we haven't been properly introduced. May I know your name?

7. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

8. I always wake up early to study because I know the early bird gets the worm.

9. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

10. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

11. I don't think we've met before. May I know your name?

12. I don't want to beat around the bush. I need to know the truth.

13. I know I should have apologized sooner, but better late than never, right?

14. I know I should have gone to the dentist sooner, but better late than never.

15. I know I should have started studying earlier, but better late than never, right?

16. I know I'm late, but better late than never, right?

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. I know things are difficult right now, but hang in there - it will get better.

19. I know this project is difficult, but we have to keep working hard - no pain, no gain.

20. I know we're behind schedule, but let's not cut corners on safety.

21. I know you're going through a tough time, but just hang in there - you're not alone.

22. I'm sorry, I didn't see your name tag. May I know your name?

23. It takes one to know one

24. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

25. May I know your name for networking purposes?

26. May I know your name for our records?

27. May I know your name so I can properly address you?

28. May I know your name so we can start off on the right foot?

29. Ngumiti lang sya, I know everything, Reah Rodriguez.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

32. Some people argue that it's better not to know about certain things, since ignorance is bliss.

33. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

34. Sorry, I didn't catch your name. May I know it again?

35. Though I know not what you are

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Tantanan mo ako sa legend legend na yan! hahaha!

2. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

3. He has become a successful entrepreneur.

4. The athlete completed a series of intense workouts to prepare for the competition.

5. Algunas personas coleccionan obras de arte como una inversión o por amor al arte.

6. We have already paid the rent.

7. Nang matanggap ko ang pagbati at papuri sa aking gawa, ang aking kaba at pag-aalinlangan ay napawi.

8. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

9. Alam ko na mayroong magandang intensyon ang kanilang plano, ngunit hindi ako sang-ayon dito kaya ako ay tumututol.

10. Ang talambuhay ni Gregorio del Pilar ay nagpapakita ng kanyang katapangan sa laban para sa kalayaan ng bansa.

11. Kucing dapat dilatih untuk melakukan beberapa trik seperti menjulurkan tangan untuk berjabat tangan atau melompat melalui ring.

12. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

13. En el legado de Da Vinci se encuentra una gran cantidad de cuadernos y dibujos de sus estudios.

14. The telephone has undergone many changes and improvements since its invention

15. Jeg har opnået stor erfaring gennem mit arbejde med at lede projekter.

16. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

17. Selamat pagi, bagaimana kabar Anda? - Good morning, how are you?

18. He has been to Paris three times.

19. Cutting corners might save time now, but it will cause problems down the line.

20. The art class teaches a variety of techniques, from drawing to painting.

21. Kulay pula ang libro ni Juan.

22. La labradora de mi amiga es muy obediente y siempre viene cuando la llaman.

23. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

24. Gracias por entenderme incluso cuando no puedo explicarlo.

25. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

26. Pumulot siya ng mga bao ng niyog, gamit na panggatong sa apoy, at hinagis sa lola.

27. Ang daddy ko ay masipag.

28. Players move the ball by kicking it and passing it to teammates.

29. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

30. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

31. Gelai, siya si Tito Maico. sabi ko sabay turo kay Maico.

32. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

33. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

34. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

35. Las hojas de té son muy saludables y contienen antioxidantes.

36. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

37. Anong oras sila umalis sa Camp Crame?

38. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

39. Isa kang hampaslupa! saad ng matapobreng babae.

40. Kumaripas ng takbo ang batang may dalang bola nang makita ang kanyang nanay.

41. Los powerbanks suelen tener puertos USB que permiten conectar diferentes tipos de dispositivos.

42. Les chimistes travaillent sur la composition et la structure de la matière.

43. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

44. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

45. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

46. In this industry, singers who can't write their own songs are a dime a dozen.

47. Ang biglang pag-alsa ng mga manggagawa ay binulabog ang industriya ng paggawa.

48. I reached my credit limit on the card and couldn't make any more purchases.

49. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

50. Kumusta ang nilagang baka mo?

Similar Words

knowsknowledgeknow-howknown

Recent Searches

ctilesknowpinagpapaalalahanankinukuyomownstyrepinatiragulonararamdamansoportengahumanosfallaupangkayabanganpinapakinggannamumulaklaksupplynabigkaspagsubokmagsi-skiingnapatunayanmaaliwalaseffortsbansangbatayindustriyapronoundesarrollarondalawangmonetizingissueskapaligirankakaibangnumerososverykamag-anaksuothouseyanjeetgassapagkatgawingtacto11pmlimahankawalsinikappaslitenergyarghnagdadasalcommercialcourtadecuadoliabletagapagmananagbalikmaingaylobbykampolalamunannagsilabasannatalomatatandaampliamakabalikpoolbuslonakapapasongpinagkakaabalahanwhichlucypinakamaartengbeginninginaabutanpersonalnahihirapanlakadtelangmayamayanagpipiknikikinatatakotumiisodbutmatagalihandaitopagdidilimmasipagkaydatipusangalmusalmag-uusapsaanagwadornagmamaktolmatutogamitinbook,rektangguloformapatinakatigilafterintindihinrenacentistamatanakitulogpowerlimatikdereswingakobodadreamresignationnakakitasapatosnatinghilingherunderblogelijeadoptedngangmagkakagustobagkusperosueloideologiesnakatagomasayang-masayatemparaturamorningtrentatahimiklalongpalaymabutipalikuranbituinmapagkatiwalaantiranteimpacttumawafuelhateheianungnaiwangimprovepesoswereabstainingpaghuhugaspunobaliwnakatuklawnakakasulatnewspaperspinagtulakanpagkapitasginoongmakatawakaparusahansistemastarsenhederkasamarebopartsabinausalgandaalignstalentbastababainordersharkusenagpasyafansnotpagkapanalopasosonesarilingbaldengexpertfluidityrepresentativessagapendviderekasoymagtatagalbuti