Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "leading"

1. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

2. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

3. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

4. Holy Week is a Christian observance that commemorates the last week of Jesus Christ's life on Earth, leading up to his crucifixion and resurrection.

5. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

6. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

7. Smoking is a leading cause of preventable death worldwide.

8. The CEO received a hefty bonus for successfully leading the company through a period of growth.

9. The musician released a series of singles, leading up to the release of her album.

10. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

11. Tim Duncan was a fundamental force in the NBA, leading the San Antonio Spurs to numerous championships.

12. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

Random Sentences

1. Kanser ang ikinamatay ng asawa niya.

2. Hindi naman halatang type mo yan noh?

3. Nahulog ang bola sa kanal kaya’t hindi na nila ito nakuha.

4. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

5. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

6. Hindi niya namalayan na tatlong oras na siyang tulala sa harap ng kanyang computer.

7. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

8. Kumain ka ng gulay upang maging malusog ka.

9. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

10. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

11. Siya ay apatnapu't limang taong gulang at nakapangasawa sa isa sa mga magaling tumugtog ng piyano

12. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

13. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

14. Ang parusang angkop sa suwail na anak ay iginawad.

15. Les enfants ont des besoins de santé particuliers qui doivent être pris en compte.

16. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

17. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

18. We celebrated their promotion with a champagne toast and a slice of cake.

19. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

20. Si Jose Rizal ay napakatalino.

21. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

22. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

23. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

24. She has completed her PhD.

25. Smoking is a leading cause of preventable death worldwide.

26. Let's keep things in perspective - this is just a storm in a teacup.

27. Kapansin-pansin ang dami ng mga insekto na naglipana sa gabi.

28. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

29. Prost! - Cheers!

30. Gagawa ako ng tsaa pagkatapos kong kumain.

31. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

34. Ohne Fleiß kein Preis.

35. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

36. Natapakan ako ni Juliet habang sumasayaw.

37. Ipinanganak si Emilio Aguinaldo noong Marso 22, 1869, sa Kawit, Cavite.

38. Ayaw niya ng maarte at mataas na presyo kaya lagi siyang nagbabakasakali sa mga mababang halaga.

39. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

40. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

41. Oh! What a coincidence, dito ka pala nagtatrabaho?

42. Mahirap hanapin ang katotohanan sa kaibuturan ng kaso.

43. Ang sugal ay isang hindi wastong paraan ng paghahabol ng pera at tagumpay.

44. La tos puede ser un síntoma de afecciones menos comunes, como la sarcoidosis y la fibrosis pulmonar.

45. Ang pagkakaroon ng karamay at suporta mula sa mga mahal sa buhay ay makatutulong upang malunasan ang pangamba.

46. La realidad es a menudo más compleja de lo que parece.

47. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

48. Hanggang gumulong ang luha.

49. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

50. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

Recent Searches

leadingangkanmalumbaylookedbugtongputiloricolourproducirbranchesngpuntadinifaultsumapitibalikkwebangfakelabingtingaudio-visuallygisingkapilingulocommunicateguidehateexampledebatesiponggraduallyinfinitydoontalepdaideaauthortiposnothingpagtingindeliciosasharmainekalayuannakapasoknagmadalingpagpanhikpinagbigyannaulinigandiretsahangmatalinorevolutioneretmanghikayatmahihirapnaguguluhandalawadoingdatarequireinteligenteslargethreenariningcasesestablishedjunioclientesguiltyalincleancespinakabatangnagbanggaannagbabakasyonnakaupokasalukuyanpagsasalitadi-kawasaagwadorprovidednahulidependnakasahodhubad-baromonsignornakalilipasnanahimiklabing-siyampamilyangnakakatulongnapatawagikinakagalithila-agawanmaihaharapnaglipanangfilmnuonbutasgasmenhealthierkakapanoodberetiexpensesbasurabungadmagpasalamatnakatitiginilistapumiligasolinamahinanakikitangsinaliksikpilipinasnaiilangnaghihirapnaapektuhannakauwitumunognakapasapagkakatayooverbeendepartmentnagtaposdamdaminiligtaspaosnakangisingbinentahanalaganglumabasusuariohouseholdinterests,mangyaripangarapipinambilitmicasahigmaskaramenskontrapangalananpadalasisinaramusicalkalabantsinamatutongmagkasinggandapuedeskumilospaggawaanumanricomaongalagatelevisionilagaysementopampagandamatalimallesikatsarongbecameteachernasanklasengmatulissumisilipginaganoonbinibilangtusindvissalbahepaldahoymangingibigsisidlanhagdanganunrevolutionizedkararatingubomasasabidisyembremakasarilingdemocraticadoptedpinangalanangwashingtonsinimulannaka-smirkkwenta-kwentamalabobabasahineksamnanlalamigkrussasakyannatitirang