Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "you,"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "Dogs are like potato chips, you can't have just one."

3. "You can't teach an old dog new tricks."

4. **You've got one text message**

5. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

6. Aku merindukanmu, sayang. (I miss you, dear.)

7. Aku rindu padamu. - I miss you.

8. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

9. Apa kabar? - How are you?

10. Apa yang bisa saya bantu? - How can I help you?

11. Are you crazy?! Bakit mo ginawa yun?!

12. As a lender, you earn interest on the loans you make

13. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

14. Bagaimanakah kabarmu hari ini? (How are you today?)

15. Bis bald! - See you soon!

16. Bis morgen! - See you tomorrow!

17. Bis später! - See you later!

18. Bitte schön! - You're welcome!

19. Bless you.. tugon ko sa biglang pagbahing nya.

20. Butterfly, baby, well you got it all

21. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

22. Can you please stop beating around the bush and just tell me what you really mean?

23. Come on, spill the beans! What did you find out?

24. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

25. D'you know what time it might be?

26. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

27. Don't beat around the bush with me. I know what you're trying to say.

28. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

29. Don't underestimate someone because of their background - you can't judge a book by its cover.

30. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

31. Es freut mich, Sie kennenzulernen. - Nice to meet you.

32. For you never shut your eye

33. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

34. Haha! I'd want to see you fall inlove tonight.

35. Happy birthday to my best friend, I hope you have a wonderful day!

36. Have you been to the new restaurant in town?

37. Have you eaten breakfast yet?

38. Have you ever traveled to Europe?

39. Have you studied for the exam?

40. Have you tried the new coffee shop?

41. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

42. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

43. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

44. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

45. How I wonder what you are.

46. How I wonder what you are.

47. Humarap sya sakin, What d'you mean locked?!!

48. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

49. I can tell you're beating around the bush because you're not looking me in the eye.

50. I don't have time for you to beat around the bush. Just give me the facts.

51. I know you're going through a tough time, but just hang in there - you're not alone.

52. I love you so much.

53. I love you, Athena. Sweet dreams.

54. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

55. If you did not twinkle so.

56. If you don't want me to spill the beans, you'd better tell me the truth.

57. If you keep beating around the bush, we'll never get anywhere.

58. If you keep cutting corners, the quality of your work will suffer.

59. If you quit your job in anger, you might burn bridges with your employer and coworkers.

60. If you spill the beans, I promise I won't be mad.

61. If you think he'll agree to your proposal, you're barking up the wrong tree.

62. If you think he'll lend you money, you're barking up the wrong tree.

63. If you think I'm the one who broke the vase, you're barking up the wrong tree.

64. If you think I'm the one who stole your phone, you're barking up the wrong tree.

65. If you think she'll forgive you, you're barking up the wrong tree.

66. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

67. If you want to get the best deals at the farmer's market, you have to be the early bird.

68. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

69. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

70. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

71. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

72. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

73. If you're trying to convince me that he's a bad person, you're barking up the wrong tree.

74. If you're trying to get me to change my mind, you're barking up the wrong tree.

75. In the dark blue sky you keep

76. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

77. Investing in the stock market can be risky if you don’t do your research.

78. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

79. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

80. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

81. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

82. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

83. It's nothing. And you are? baling niya saken.

84. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

85. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

86. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

87. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

88. Keep practicing and hang in there - you'll get better at it.

89. Keep studying and hang in there - you'll pass that test.

90. Make sure to keep track of your sources so that you can properly cite them in your book

91. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

92. May I know your name so I can properly address you?

93. My name's Eya. Nice to meet you.

94. Nice meeting you po. automatic na sabi ko.

95. Nice meeting you po. nag smile sila tapos nag bow.

96. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

97. Oh gosh, you're such an ambisyosang frog!

98. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

99. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

100. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

Random Sentences

1. En boca cerrada no entran moscas.

2. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

3. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

4. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

5. Sumakay kami ng kotse at nagpunta ng mall.

6. Las personas pobres a menudo enfrentan barreras para acceder a la justicia y la igualdad de oportunidades.

7. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

8. Nakita rin kita! ang sabi niyang humihingal

9. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

10. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

11. Bumalik ako sa dakong huli para iwan ang aking cellphone na naiwan ko sa table.

12. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

13. Ina, huwag mo po kaming iwan! ang iyak ni Maria.

14. Kung anong puno, siya ang bunga.

15. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

16. Matapos magbabala ay itinaas ng matanda ang baston.

17. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

18. Las plantas con flores se reproducen a través de la polinización, en la que los insectos u otros agentes transportan el polen.

19. Bigla siyang bumaligtad.

20. Dumating ang bus mula sa probinsya sa hatinggabi.

21. Utiliza métodos orgánicos para combatirlas, como el uso de polvos de hierbas o infusiones

22. Les biologistes étudient la vie et les organismes vivants.

23. Women have the ability to bear children and have historically been associated with nurturing and caregiving roles.

24. The stock market gained momentum after the announcement of the new product.

25. Nagliliyab ang kalangitan sa gabi dahil sa mga paputok.

26. Have you eaten breakfast yet?

27. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

28. La música es una parte importante de la cultura española y se celebra en numerosos festivales y eventos a lo largo del año

29. Dumating ang mga atleta sa entablado nang limahan.

30. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Durante el invierno, las personas usan ropa más abrigada como abrigos, gorros y guantes.

33. Ang guro ko sa Panitikan ay nagturo sa amin ng mga panitikan mula sa iba't ibang panahon.

34. Sa mga pinagdadaanan natin sa buhay, kailangan nating maging handa sa agaw-buhay na mga pagkakataon.

35. Pupunta ako sa Germany sa susunod na taon.

36. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

37. Seguir nuestra conciencia puede requerir coraje y valentía.

38. She was feeling tired, and therefore decided to go to bed early.

39. From: Beast Nasaan ka? Bakit di mo ako hinintay?

40. Kahit hindi ako nagpapakita ng kilos, crush kita pa rin sa loob ng puso ko.

41. El maíz necesita sol y un suelo rico en nutrientes

42. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

43. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

44. Mahilig maglaro ng video games si Marvin.

45. Habang naglalakad ako sa dalampasigan, natatanaw ko ang malalaking alon na dumadampi sa baybayin.

46. Biglaan kaming nag-decide na magbakasyon sa beach ngayong weekend.

47. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

48. The film director produced a series of short films, experimenting with different styles and genres.

49. Ikinukwento niya ang mga masasayang alaala ng kanyang kabataan na ikinalulungkot niyang wala na.

50. They organized a marathon, with all proceeds going to charitable causes.

Recent Searches

you,unohayopbulakbabaepinaladmaglinisdatingnakabaonkayongkasaysayansaanaktibistalimitedsangkalanresourcesnangdalagangmoviesblueslabimetroecijabahay-bahayanreviewparingsaferhaltnapomaulinigansangpagamutankasaganaanestilosmalambothomesdealdalawasadyangkanyasinapokligawangitaraagadnanahimikbakitanjonyanilutofulfillingboholzebrayearnag-angatpansamantalaknowsinulityayaaustraliapwederememberedpagpapakilalapaanongmemorianasundomesangdiednag-pilototamadkinamumuhiancementedbumotohiningaouryatacosechasbagamatgameitinatagyakapinpamilyaramonmay-aripag-asanaminsinuotknowkalikasanlovealinghatingbayangmethodsdamittala1977supplytaglagascommunicatenangagsibilimeronfathersantopapanhikutak-biyametodemangangalakalmay-bahaypabalangsabiglobalisasyonnakakunot-noongsana-allkamisetanewsmakabiligalitnakatingindisposalmitigatesofamurahoneymoonersplansubaliteditorbayaningkawalaninstrumentalspaghettiparangkwebaaudithundredtuwiduntimelymagnanakawsumalimasikmuravotesnagbiyayabakasyonmalapitanmangsimpelmalusogbingbingnagpuntahantiradornabiawangleksiyonkantaitinanimskillsditominamadalihalamannaghatidjapankuwentokaibigannaglulutoinalistsuperpagkabatahadprinsesangownkumikiloselepantecedulatekacharmingpag-iinatrequirenagmumukhamawawalareboundtsakagumigisingiskedyulbilerumangatpinabulaanumaalisnagagalitmatamanwritingindvirkningundascontinuemagdoorbellendingpinasalamatanmateryaleskamaounitedmatalinoikinagalitmamahalin