Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "you,"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "Dogs are like potato chips, you can't have just one."

3. "You can't teach an old dog new tricks."

4. **You've got one text message**

5. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

6. Aku merindukanmu, sayang. (I miss you, dear.)

7. Aku rindu padamu. - I miss you.

8. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

9. Apa kabar? - How are you?

10. Apa yang bisa saya bantu? - How can I help you?

11. Are you crazy?! Bakit mo ginawa yun?!

12. As a lender, you earn interest on the loans you make

13. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

14. Bagaimanakah kabarmu hari ini? (How are you today?)

15. Bis bald! - See you soon!

16. Bis morgen! - See you tomorrow!

17. Bis später! - See you later!

18. Bitte schön! - You're welcome!

19. Bless you.. tugon ko sa biglang pagbahing nya.

20. Butterfly, baby, well you got it all

21. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

22. Can you please stop beating around the bush and just tell me what you really mean?

23. Come on, spill the beans! What did you find out?

24. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

25. D'you know what time it might be?

26. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

27. Don't beat around the bush with me. I know what you're trying to say.

28. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

29. Don't underestimate someone because of their background - you can't judge a book by its cover.

30. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

31. Es freut mich, Sie kennenzulernen. - Nice to meet you.

32. For you never shut your eye

33. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

34. Haha! I'd want to see you fall inlove tonight.

35. Happy birthday to my best friend, I hope you have a wonderful day!

36. Have you been to the new restaurant in town?

37. Have you eaten breakfast yet?

38. Have you ever traveled to Europe?

39. Have you studied for the exam?

40. Have you tried the new coffee shop?

41. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

42. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

43. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

44. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

45. How I wonder what you are.

46. How I wonder what you are.

47. Humarap sya sakin, What d'you mean locked?!!

48. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

49. I can tell you're beating around the bush because you're not looking me in the eye.

50. I don't have time for you to beat around the bush. Just give me the facts.

51. I know you're going through a tough time, but just hang in there - you're not alone.

52. I love you so much.

53. I love you, Athena. Sweet dreams.

54. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

55. If you did not twinkle so.

56. If you don't want me to spill the beans, you'd better tell me the truth.

57. If you keep beating around the bush, we'll never get anywhere.

58. If you keep cutting corners, the quality of your work will suffer.

59. If you quit your job in anger, you might burn bridges with your employer and coworkers.

60. If you spill the beans, I promise I won't be mad.

61. If you think he'll agree to your proposal, you're barking up the wrong tree.

62. If you think he'll lend you money, you're barking up the wrong tree.

63. If you think I'm the one who broke the vase, you're barking up the wrong tree.

64. If you think I'm the one who stole your phone, you're barking up the wrong tree.

65. If you think she'll forgive you, you're barking up the wrong tree.

66. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

67. If you want to get the best deals at the farmer's market, you have to be the early bird.

68. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

69. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

70. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

71. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

72. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

73. If you're trying to convince me that he's a bad person, you're barking up the wrong tree.

74. If you're trying to get me to change my mind, you're barking up the wrong tree.

75. In the dark blue sky you keep

76. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

77. Investing in the stock market can be risky if you don’t do your research.

78. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

79. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

80. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

81. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

82. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

83. It's nothing. And you are? baling niya saken.

84. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

85. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

86. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

87. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

88. Keep practicing and hang in there - you'll get better at it.

89. Keep studying and hang in there - you'll pass that test.

90. Make sure to keep track of your sources so that you can properly cite them in your book

91. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

92. May I know your name so I can properly address you?

93. My name's Eya. Nice to meet you.

94. Nice meeting you po. automatic na sabi ko.

95. Nice meeting you po. nag smile sila tapos nag bow.

96. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

97. Oh gosh, you're such an ambisyosang frog!

98. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

99. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

100. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

Random Sentences

1. We admire the dedication of healthcare workers in the midst of the pandemic.

2. Medarbejdere skal ofte undergå årlig evaluering af deres præstation.

3. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

4. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

5. Berapa harganya? - How much does it cost?

6. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

7. Håbet om at opnå noget kan give os styrke og energi.

8. Ang doktor ay pinagpalaluan ng kanyang mga pasyente dahil sa kanyang husay sa pagpapagaling.

9. Sinong may sabi? hamon niya sa akin.

10. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

11. Ang ganda talaga nya para syang artista.

12. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

13. Protecting the environment requires a collective effort from individuals, organizations, and governments.

14. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

15. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

16. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

17. Masarap ang pagkain sa restawran.

18. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

19. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

20. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

21. Saan-saan kayo lumibot sa Amerika?

22. Malikot ang kanyang mga mata nang siya'y bumangon at itukod ang mga kamay sa semento.

23. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

24. Pumupunta siya sa Amerika taun-taon.

25. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

26. Ano namang inasikaso mo sa probinsya?

27. Gusto kong bumili ng bestida.

28. El deportista produjo un gran esfuerzo para ganar la competencia.

29. "A dog's love is unconditional."

30. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

31. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

32. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

33. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

34. The cake is still warm from the oven.

35. The team's colors are purple and gold, and they play their home games at the Staples Center.

36. Malaki ang kama sa kuwarto ni Olivia.

37. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

38. Hinawakan ko yung tiyan ko, Konting tiis na lang..

39. Ano ang gusto mong panghimagas?

40. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

41. When we forgive, we open ourselves up to the possibility of reconciliation and rebuilding damaged relationships.

42. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

43. Hindi ko akalaing capable ka palang tumawa.

44. Ang daming limatik sa bundok na kanilang inakyat.

45. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

46. Uwi na tayo.. Ayoko na dito sa ospital..

47. Ang tissue ay mabilis higupin ang tubig.

48. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

49. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

50. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

Recent Searches

you,andynaglaonmagomfattendelumibotnagpapantalkarapatangalbularyodanskepunsoibotomalakassumalakamukhanatanggappasyalannakukuhapatunayantinangkanagsidaloscientificestosamoyalessingerkumikilospatientaminimportantesmasayahinpamilihang-bayankayapinyaritwallistahanpamamalakadhabilidadesattackpalagievolvedaplicacionesgrupoconclusionlingidcivilizationmag-asawaskabtnakiisasignalnagbagomagta-taxiskypenamulaklakdibisyonbodegaburmaipalinisplayednakadapadiagnosesmakisigrobertpanahonbutil1935nabasatumiralikodshortcausesinhalesasakaykaramihanbawatfriesaanmapilitangpagkakahiwapulismorepunung-punodibdibkendtallottedlakaskirbycomputere,taingahinamakmeaningsahigsabadmalampasanpag-aralindisyempresaudizoohatinggabiselebrasyonipagpalitsarabigbagamatdi-kawasasumaliindividualsmariantinigcomputerspropensowerenaisuusapantinitignanminsankayotaoskalakiconsueloedadginoongadvanceskaintelephonehappiergandamalambingnootusindvistuminginikawcompletingledtransportmidlerfacebookusingdalawakainitanlucasnangapatdanvitalkinissdettenapakamunangnanalopangingimiganangbasketballmapa,westmarasiganpagsasalitasusunodmasinoppagbubuhatankasabaymapagbigaygayundinpagkalungkotmapag-asanghadwarimapayapamaubosmarumibayadbotomaputisidopatuloynag-replyrailwaysnaiwangayudanakapagtaposbinibiyayaannagbibigayorasstarsmarahangmedianakakalasingpagmamanehomarahasthereforemalilimutankalayaanthankspinapakingganiniibiglegislationpagkakatuwaanmatandangcalidadkahapondoneipongmaraming