Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "has"

1. "Every dog has its day."

2. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

3. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

4. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

5. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

6. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

7. Amazon has a reputation for being innovative and forward-thinking.

8. Amazon has a vast customer base, with millions of customers worldwide.

9. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

10. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

11. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

12. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

13. Amazon started as an online bookstore, but it has since expanded into other areas.

14. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

15. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

16. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

17. Another area of technological advancement that has had a major impact on society is transportation

18. Aquaman has superhuman strength and the ability to communicate with marine life.

19. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

20. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

21. ¿Cómo has estado?

22. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

23. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

24. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

25. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

26. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

27. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

28. Cryptocurrency has faced regulatory challenges in many countries.

29. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

30. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

31. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

32. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

33. Every cloud has a silver lining

34. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

35. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

36. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

37. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

38. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

39. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

40. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

41. Has he finished his homework?

42. Has he learned how to play the guitar?

43. Has he spoken with the client yet?

44. Has he started his new job?

45. Has she met the new manager?

46. Has she read the book already?

47. Has she taken the test yet?

48. Has she written the report yet?

49. He has become a successful entrepreneur.

50. He has been building a treehouse for his kids.

51. He has been gardening for hours.

52. He has been hiking in the mountains for two days.

53. He has been meditating for hours.

54. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

55. He has been playing video games for hours.

56. He has been practicing basketball for hours.

57. He has been practicing the guitar for three hours.

58. He has been practicing yoga for years.

59. He has been repairing the car for hours.

60. He has been to Paris three times.

61. He has been working on the computer for hours.

62. He has been writing a novel for six months.

63. He has bigger fish to fry

64. He has bought a new car.

65. He has fixed the computer.

66. He has improved his English skills.

67. He has learned a new language.

68. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

69. He has painted the entire house.

70. He has traveled to many countries.

71. He has visited his grandparents twice this year.

72. He has written a novel.

73. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

74. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

75. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

76. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

77. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

78. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

79. Hun har en fortryllende udstråling. (She has an enchanting aura.)

80. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

81. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

82. I like how the website has a blog section where users can read about various topics.

83. Illegal drug traffic across the border has been a major concern for law enforcement.

84. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

85. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

86. In recent years, television technology has continued to evolve and improve

87. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

88. In the years following his death, Presley's legacy has continued to grow

89. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

90. Instagram has become a platform for influencers and content creators to share their work and build a following.

91. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

92. It has been found that by abstaining from smoking a person may be cured of many diseases

93. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

94. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

95. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

96. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

97. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

98. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

99. Kevin Durant is a prolific scorer and has won multiple scoring titles.

100. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

Random Sentences

1. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

2. They may draft and introduce bills or resolutions to address specific concerns or promote change.

3. A couple of cars were parked outside the house.

4. Después de la lluvia, el sol sale y el cielo se ve más claro.

5. Masarap ang bawal.

6. Isang araw, naabutan ni Nicolas si Helena sa palasyo.

7. Napaluhod nalang siya sa harap ng palasyo at umiyak.

8. Have you been to the new restaurant in town?

9. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

10. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

11. Ang Sabado de Gloria ay tahimik

12. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

13. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

14. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

15. Naglalambing ang aking anak.

16. Nag-aaral tayo ng Tagalog ngayon.

17. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

18. Isang maliit na kubo ang nakatayo sa itaas ng baranggay, sa tagiliran mismo ng bundok na balot ng makapal na gubat.

19. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

20. Landet er et godt eksempel på, hvordan man kan skabe en velfungerende

21. Walang ilog ang hindi puno ng isda.

22. Sa baguio nila napiling mag honeymoon.

23. La creatividad nos permite expresarnos de manera única y personal.

24. Minsan, nagulat ang pamilya sa pagdating ni Roque dahil may kasama itong lalaking may sugat.

25. It's important to read food labels to understand ingredients and nutritional information.

26. Jeg har fået meget værdifuld erfaring gennem min karriere.

27. Aray! Bakit mo ako sinapak! Potaena mo naman!

28. The momentum of the rocket propelled it into space.

29. Ikaw ang iniisip ko bawat oras ng buhay ko.

30. Habang nagbabaga ang araw ay isinakripisyo ng misyunero ang abang buhay.

31. The website's user interface is very user-friendly and easy to navigate.

32. "Walang imposible basta may tiyaga," ani ng isang matagumpay na negosyante.

33. Agad niyang dinala ito kay Mang Sanas.

34. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

35.

36. Lumibot sila sa kagubatan upang masulyap ang kagandahan ng kalikasan.

37. Para sa anak ni Consuelo ang T-shirt.

38. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

39. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

40. Madalas lang akong nasa library.

41. Don't beat around the bush with me. I know what you're trying to say.

42. Nagtaka ang bata sapagkat walang nangyari sa babae; sa halip nakangiti nitong ibinigay ang prutas sa bata na siya namang tinikman din ang bunga.

43. Pumunta ako sa Iloilo noong tag-araw.

44. Storm can control the weather, summoning lightning and creating powerful storms.

45. He has been practicing yoga for years.

46. Pasensya na pero kailangan ko nang umalis.

47. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

48. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

49. May pitong taon na si Kano.

50. Después de leer el libro, escribí una reseña en línea.

Similar Words

nangahasPalibhasaParehasahasbihasamangahasmarahasMuchashastaemphasizedemphasiscosechas

Recent Searches

hasnapapadaantextobroadcastcleanpepericamadadalauntimelypinalayaswaitnaglakadkakayananclockoueprogramming,makapilingworkshopoutposttinignanipinamahiwagangnatatawanegosyoi-rechargepagkalitobayadpagmasdaninihandatumaliwasmarioatagiliraneyenakataasheynagpasamahimighouseholdnasasakupanpagsigawturismomaulinigannataposmagtagolalongpinakamatabangmulighedermabigyankulayrevolutioneretnaguguluhanmonumentoiiwansasambulatputolmahinangnagkalapiteskuwelabinawiahitdarknitosentencemaaaribotongngunithomesresortmalakingpollutionilocoslacktimelabahinginaganoonkasamaangnakabaonnagdaoskinantamanghikayatmatesadeliciosahinamakindependentlytalabasahansobragrabefilmartistkuwartopublicationtogetherenglandmassachusettsdiseasepupuntahantumagallegislationmadungisstatuskikokinakainrenombreselalegacykoreamadamistarcitizenssundalofulfillmentomelettenuclearhospitalbeforekunestrengthjuicegympagiisipdahan-dahantipownsongtondonyenalugmokgawinmensajesanimagsi-skiingsinapokartistasakoplibangansakinseennapakaraminggalingnakikini-kinitanakakuhanagmakaawalasingtinalikdanmanalopagsayadgabepatrickngpuntasabihingmini-helicoptermasyadokablanjeromepagbahingpagpasensyahan11pmnababalotsakitnagdabogsampungmagkitatibokbayanbayawakiskoeneromaymaglalabingnaguusapulapkaindesisyonankondisyonpowerselepantehinamabatongmasarapbutillimahanshippopularnakakasamaawitanlamesamasamangtravelermakabaliknagtawananpilingpigilantagaroonspaghettinamumulaklakstorymakatulongmangangalakalsinimulan