Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "has"

1. "Every dog has its day."

2. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

3. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

4. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

5. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

6. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

7. Amazon has a reputation for being innovative and forward-thinking.

8. Amazon has a vast customer base, with millions of customers worldwide.

9. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

10. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

11. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

12. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

13. Amazon started as an online bookstore, but it has since expanded into other areas.

14. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

15. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

16. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

17. Another area of technological advancement that has had a major impact on society is transportation

18. Aquaman has superhuman strength and the ability to communicate with marine life.

19. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

20. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

21. ¿Cómo has estado?

22. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

23. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

24. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

25. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

26. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

27. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

28. Cryptocurrency has faced regulatory challenges in many countries.

29. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

30. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

31. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

32. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

33. Every cloud has a silver lining

34. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

35. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

36. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

37. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

38. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

39. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

40. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

41. Has he finished his homework?

42. Has he learned how to play the guitar?

43. Has he spoken with the client yet?

44. Has he started his new job?

45. Has she met the new manager?

46. Has she read the book already?

47. Has she taken the test yet?

48. Has she written the report yet?

49. He has become a successful entrepreneur.

50. He has been building a treehouse for his kids.

51. He has been gardening for hours.

52. He has been hiking in the mountains for two days.

53. He has been meditating for hours.

54. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

55. He has been playing video games for hours.

56. He has been practicing basketball for hours.

57. He has been practicing the guitar for three hours.

58. He has been practicing yoga for years.

59. He has been repairing the car for hours.

60. He has been to Paris three times.

61. He has been working on the computer for hours.

62. He has been writing a novel for six months.

63. He has bigger fish to fry

64. He has bought a new car.

65. He has fixed the computer.

66. He has improved his English skills.

67. He has learned a new language.

68. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

69. He has painted the entire house.

70. He has traveled to many countries.

71. He has visited his grandparents twice this year.

72. He has written a novel.

73. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

74. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

75. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

76. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

77. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

78. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

79. Hun har en fortryllende udstråling. (She has an enchanting aura.)

80. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

81. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

82. I like how the website has a blog section where users can read about various topics.

83. Illegal drug traffic across the border has been a major concern for law enforcement.

84. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

85. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

86. In recent years, television technology has continued to evolve and improve

87. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

88. In the years following his death, Presley's legacy has continued to grow

89. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

90. Instagram has become a platform for influencers and content creators to share their work and build a following.

91. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

92. It has been found that by abstaining from smoking a person may be cured of many diseases

93. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

94. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

95. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

96. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

97. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

98. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

99. Kevin Durant is a prolific scorer and has won multiple scoring titles.

100. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

Random Sentences

1. Gaano kalaki ho ang gusto niyo?

2. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

3. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

4. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

5. The business started to gain momentum after a successful marketing campaign.

6. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

7. The baby is sleeping in the crib.

8. Narito ang pagkain mo.

9. Nagpunta ako sa may kusina para hanapin siya.

10. Durante el invierno, algunos lugares experimentan nevadas y paisajes cubiertos de blanco.

11. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

12. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

13. Nakatanggap umano siya ng isang liham mula sa isang taong matagal nang nawala.

14. There were a lot of flowers in the garden, creating a beautiful display of colors.

15. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

16. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

17. Lumalakad siya ngayon na walang-tiyak na patutunguhan.

18. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

19. Scissors are a cutting tool with two blades joined together at a pivot point.

20. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

21. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

22. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

23. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

24. Ahh... haha. Umiling na lang ako bilang sagot.

25. Kung may mananagot niyan ay walang iba kundi ang pobreng tsuper.

26. La santé est un état de bien-être physique, mental et social complet.

27. May I know your name so we can start off on the right foot?

28. Ang lakas ng ilaw ng kanyang flash light.

29. Nakarating na si Ana sa gubat at pumasok sa isang kweba at lumabas ng may dalang basket na puno ng ibat-ibang uri ng gulay.

30. Nagsusulat ako ng aking journal tuwing gabi.

31. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

32. Hindi mo gusto ang alok na trabaho? Kung gayon, maaari kang maghanap ng ibang oportunidad.

33. Saya sayang dengan keindahan alam di Indonesia. (I love the natural beauty of Indonesia.)

34. Ang kakahuyan sa bundok ay mayabong at puno ng iba't ibang mga uri ng mga halaman.

35. Iyong kulay itim na bag ang bag ko.

36. The backpack was so hefty, it felt like it weighed a ton.

37. Mahalagang magpakumbaba at magpakatotoo sa bawat sitwasyon, samakatuwid.

38. Bakit hindi nya ako ginising?

39. Tulala siyang tumitig sa malawak na tanawin ng dagat.

40. Ano ang dapat gawin ng pamahalaan?

41. Iiwan lang kita pag sinabi mong iwanan na kita..

42. Taga-Ochando, New Washington ako.

43. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

44. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

45. Sa mga himig ng kundiman, nadarama ang tibok ng puso at pagkakaisa ng mga Pilipino.

46. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

47. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

48. The market is currently facing economic uncertainty due to the pandemic.

49. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

50. Palmesøndag er den første dag i Holy Week og markerer Jesu triumfmodtagelse i Jerusalem.

Similar Words

nangahasPalibhasaParehasahasbihasamangahasmarahasMuchashastaemphasizedemphasiscosechas

Recent Searches

generatehaspapuntaplatformstommabutingataquessurgeryvasquesdevicesadventhanapbuhayfredreadingmichaelrelativelybehindbakepinilingnothingfurthercallpare-parehokalikasaninvestasawagustotayoumakbayeconomicwhiledependingkasingbitbitofteninternaallowedeitherawitanincreasedactivitykapangyarihanmagkasabayikinalulungkotika-12kapamilyamaawaingsalamangkeropagpapakalatnamulaklakkinatatalungkuangtumatanglawjingjingmarasigangulatnabubuhaynabighaniganitomangahashahahadiferenteshumahangostulongnakaka-inpinapakiramdamanmainittawananandreagawapampagandadakilangeroplanobesespangkatmagselospagkasabimaglalaronagtataeginawaasiaticnagawangmagpahabasampungparurusahancapitalkalaunannagtungoaberkundimanbilhinpeepmodernemaya-mayagandahanginagawamalimitbinabaannakatirautak-biyanami-misscandidatesenforcingaggressionpaghangaduwendemaintindihankuboiniiroghelloknowledgedahan-dahannaiscanteenanimales,lolatalagangblusabinatotoretehalikteleponokinagayunpamannakakitakasiyahantumiramagkaparehonahuhumalingreservationmatulunginnalugmokpakinabangankatagamakakibomakabawipronounmaaariumiisodsistemasdolyarumiimikmatangkaddahilbagohila-agawanpalasyofollowedpakibigyanmasaholtumatawadbundokbumangonbasketballmagsimulagospeltomorrownahulaansadyanglumbaytinungokaliwadesarrollartsuperinalagaanyumaohitsuramahalagaturismodogsmaidtapeyumabongnunocivilizationrailwaysnakaraansabadongmagturotumalimtinulak-tulakpinakamatabanginisplacetoothbrushroboticbalangibinaonhealthierpalayanellencommunicationslibagyoncouldtanyagvitaminnakakainngitipagsidlandoon