Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "pinagsikapan"

1. Lalong pinagsikapan ng paring Kastila ang pagtuturo ng buhay at mga aral ni HesuKristo.

Random Sentences

1. Napalayo ang talsik ng bola nang ito’y sipain ni Carlo.

2.

3. Writing a book is a long process and requires a lot of dedication and hard work

4. This is not the time to fall apart, pull yourself together and think clearly.

5. At vedligeholde en regelmæssig træningsrutine kan være udfordrende, men belønningerne for ens sundhed og velvære kan være betydelige.

6. Fathers can be strong role models, providing guidance and support to their children.

7. Kepulauan Raja Ampat di Papua adalah salah satu tempat snorkeling dan diving terbaik di dunia.

8. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

9. Ikinagagalak naming ipahayag na nagkaroon ng positibong pagbabago sa ating komunidad.

10. His charitable nature inspired others to volunteer at the local shelter.

11. Tumayo siya tapos humarap sa akin.

12. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

13. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

14. Biglang nagtinginan sila kay Kenji.

15. Umiling ako. Hindi naman po. nakangiti ko pang sagot.

16. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

17. La paciencia es una virtud que nos ayuda a ser mejores personas.

18. At følge sine drømme kan føre til stor tilfredsstillelse og opfyldelse.

19. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

20. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

21. En algunas culturas, se celebran festivales de invierno como el Hanukkah y el solsticio de invierno.

22. Nagbuntong hininga sya, Akala ko naman.

23. Nang malapit nang magdilim, kumaripas na ang mga magsasaka pauwi sa kanilang tahanan.

24. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

25. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

26. Mga nuno, patawarin po ninyo ang aking anak.

27. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

28. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

29. The airport was busy, and therefore we had to arrive early to catch our flight.

30. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

31. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

32. Bumaba na sila ng bundok matapos ang ilang oras.

33. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

34. The stockbroker warned his client about investing in risky assets.

35. Dahil sa tagumpay ni Hidilyn Diaz, mas maraming Pilipino ang nagkaroon ng interes sa weightlifting.

36. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

37. He teaches English at a school.

38. Bakit kayo nagtungo sa Mendiola?

39. Hindi ah? tinaasan ko sya ng kilay.

40. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

41. Ano hong pitaka? ang sabi ng bata.

42. Holy Week markerer også starten på foråret og den nye vækst efter vinteren.

43. Mayroong hinahabol na magnanakaw sa kalsada na inaabangan ng mga pulis.

44. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

45. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

46. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

47. Ipinambili niya ng damit ang pera.

48. Omelettes are a popular choice for those following a low-carb or high-protein diet.

49. Nasa page 5 ang mapa ng Metro Rail Transit.

50. Nag-aral ng kasaysayan ang estudyante.

Recent Searches

pagkakatuwaanculturavirksomheder,pinagsikapanpioneerkagipitanmaisusuotnapapasayaunahinkare-karehinimas-himasnaglakadpagkagustonalugmokmanirahanmamalasnapapansinninanaispaglalabasasakyantv-showsmagtatanimpumilisinasabinami-missgumigisingpagguhitkatolisismolumindolhulihanenglishlaruinpinauwinangapatdankapintasangmaabutancontinuedshadesfireworksalexanderalaylenguajemalihisgabrielsumigawapoymaistorboiigibmatulispeppypuwedekuwebakasoymusiciansnatulakkamotetatlokumantafederalmagsainghanginmetodiskpagkakatayokumakalansingnagdaramdaminapagodcombinedbigla1920sbigotepalapitganamerryargueemphasizedtingtanimeffortsvideocriticsabenenatingalasinunodwaysearchdollyvampirescharmingpookpowergodbaleiconabstainingoncepasyaoueguestsinterestmasayahingurosumusunodmakakakainnaglabatruelockdownitimstrengthhalamannucleartakedaangdeleataquesfuncionescertaindifferentconvertingstudiedbitawanrawfacejohnmonitormediumvissermakikipaglaromagsubosuriintuyotcalidaddamdaminyesmedicinebalakngunitbluesutak-biyanaritopulai-rechargeheartcongratswellnapakagandaarbejdsstyrkeporbyggetarturomagbabalatagalgabingintroducecomplicatedcoachingpatience,presscandidateappnapilingmakapangyarihangmagtatagalnagbiyayamagta-trabahokinakitaannakapagreklamopinag-usapantaingasang-ayondisenyongfollowing,dekorasyonnakaririmarimhinawakaninvestingsiniyasatnaka-smirkkikitagulatnumberumiinomabundantemakauwisulyapmahinogpagkasabiumakbaymaliwanagnakahuginsektongnasiyahanyumabongnatuwabutikitaosnaliligofranciscobinge-watching