Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "spare"

1. Elektronisk udstyr kan hjælpe med at reducere energiforbrug og spare penge.

2. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

Random Sentences

1. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

2. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

3. They have already finished their dinner.

4. Biglang bumangon ang hari at hinugot ang espada.

5. Masyado ka naman nagpapaniwala kay Andrew!

6. Palibhasa ay madalas na mas matalino kaysa sa ibang mga tao sa kanyang paligid.

7. I love to eat pizza.

8. Hindi ko kayang gawin yun sa bestfriend ko.

9. I received a lot of happy birthday messages on social media, which made me feel loved.

10. My co-workers organized a surprise birthday party for me at the office.

11. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

12. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

13. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

14. Frustration is a feeling of disappointment, annoyance, or anger that arises when we are unable to achieve a desired outcome.

15. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

16. "Dogs are not our whole life, but they make our lives whole."

17. El discurso del líder produjo un gran entusiasmo entre sus seguidores.

18. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

19. Magkano ang isang kilo ng mangga?

20. Natatanaw na niya ngayon ang gripo.

21. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

22. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

23. A series of earthquakes hit the region, causing widespread damage.

24. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

25. Scissors should be handled with care to avoid injuries and kept out of reach of children.

26. Les parents sont encouragés à participer activement à l'éducation de leurs enfants.

27. Hindi madaling mahuli ang mailap na pag-asa.

28. Taon-taon ako pumupunta sa Pilipinas.

29. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

30. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

31. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

32. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

33. Napaka presko ng hangin sa dagat.

34. Kasama ang katipunan, Matapang na pinunit nina Andres Bonifacio ang cedula bilang protesta sa mga espanyol.

35. Mayroon pa ba kayong gustong sabihin?

36. Tanggalin mo na nga yang clip mo!

37. Limitar la ingesta de alcohol y cafeína puede mejorar la salud en general.

38. Ikinukwento niya ang mga masasayang alaala ng kanyang kabataan na ikinalulungkot niyang wala na.

39. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

40. Napangiti ang babae at kinuha ang pagkaing inabot ng bata.

41. Las hojas de mi cuaderno están llenas de garabatos y notas.

42. Puwede ho ba akong lumipat ng kuwarto?

43. Habang naglalakad ako sa dalampasigan, natatanaw ko ang malalaking alon na dumadampi sa baybayin.

44. Les étudiants peuvent poursuivre des études supérieures après l'obtention de leur diplôme.

45. A caballo regalado no se le mira el dentado.

46. I've been using this new software, and so far so good.

47. Gracias por iluminar mi vida con tu presencia.

48. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

49. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

50. Amazon is an American multinational technology company.

Similar Words

transparent

Recent Searches

sparemanggasumakaydiyanpahahanapmasaholnitokinagagalakpagbabagopumuslitsoccerkinamumuhianmedyopasensiyapagpapakilalahongdahileroplanoninaedukasyonbagyonumerosaskalandistancenuhalashapongalaanbumagsakdakilangcharismaticjuiceganidinittabing-dagatgusgusingyakapinkababaihankumidlatmakisuyobinangganapagodtumakassalbahedooncrucialumuulantupelonandiyan1982sanangtingnanmakikiraancommunicateprogressseryosohanginnaritoiyomarahancarolmagkaroontillhapagpuntahanmagbagotopic,dinpadabognararapatbakabakitwalanakatunghaynagsimulamaliitmesasayawansilaykapeagosteachmaluwangartemassachusettspagkabatamungkahidilawsinehanmisusedpupuntameanbalakdedicationopisinasuotcarriesgiyerapanghabambuhaybiliskurbataairportmaghahatidputolsino-sinotiyastringmayamannatinagbinililamignamalagihiwagagransiyasiglacaremakuhapethealthasawainspireunibersidad1990lumibotiniuwidahan-dahanputahemasinopsigawpaghakbanggaanonakatuonsariliinhalelumbaysubalitumalisvasqueskangitandaanghimngayonpauwinasaanpagkabiglaboxingstudentsnanoodpagkuwantabihansinosumasakaysangpabalanghampasroughmahulogpusopunokahoyexpertdisappointedanohalospinisilnakumakilalamontrealtungonakabulagtanglumakasyumaobabaetechnologypalayokhistoriapakakatandaannakahantadgawainkuneholinggomahinasutilmagturokarapatankubyertospopulationkaragatantagumpaysanayiilanlunasbarkobyggetkendtmayougalimarahildomingo