Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "influential"

1. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

2. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

3. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

4. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

5. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

6. Musk has been named one of the most influential people in the world by TIME magazine.

7. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

8. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

9. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

Random Sentences

1. Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

2. Jakarta, ibu kota Indonesia, memiliki banyak tempat wisata sejarah dan budaya, seperti Monumen Nasional dan Kota Tua.

3. Kinakailangan niyang kumilos, umisip ng paraan.

4. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

5. Les sciences sociales étudient le comportement humain et la société.

6. Mahal ang mga bilihin sa Japan.

7. Gutom ka? kinagat ko ang labi ko at tumango sa tanong nya.

8. Nagpaluto ang nanay ko ng adobo sa akin.

9. Higupin natin ang gatas habang mainit pa.

10. They watch movies together on Fridays.

11. The invention of the telephone and the internet has revolutionized the way people communicate with each other

12. Tumayo ako tapos tumayo rin si Carlo.

13. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

14. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

15. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

16. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

17. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

18. A couple of songs from the 80s played on the radio.

19. Eating a balanced diet can increase energy levels and improve mood.

20. She is playing with her pet dog.

21. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

22. El Día de San Valentín es una festividad muy popular en muchos países.

23. Nakakabahala ang mga posibleng epekto ng kanilang plano kaya ako ay tumututol.

24. Minsan kailangan din nating magmangiyak-ngiyak para maipakita natin ang totoong nararamdaman natin.

25. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

26. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

27. Ngumiti lang ako sa kanya at nagsimula muling halikan siya.

28. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

29. Magandang maganda ang Pilipinas.

30. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

31. Mahalagang magkaroon ng financial literacy upang malaman kung paano ma-manage ang mga utang.

32. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

33. His speech emphasized the importance of being charitable in thought and action.

34.

35. Ang itim mo, Impen! itutukso nito.

36. Las hojas de palmera pueden ser muy grandes y pesadas.

37. Sana po ay maibalik ko pa ang panahon upang mabigyan sila ng kasiyahan.

38. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

39. Ipanghampas mo ng langaw ang papel.

40. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

41. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

42. Ang kundiman ay patunay na ang musika ay isang malakas na kasangkapan sa pagpapahayag ng mga damdamin.

43. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

44. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

45. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

46. Has he finished his homework?

47. Sa dami ng nagnanais kumuha ng kursong iyon, mababa ang tiyansa niyang makapasok.

48. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

49. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

50. Libre si Clara sa Sabado ng hapon.

Recent Searches

influentialtuwidstrengthinternaworkingflyventalockdownexitsusunodkasingcallingstyrerryanmenuanubayanpag-aaraldecreasediikutankainmartesagilitywaribobopagsigawitinatapattahanankailangannapagodalituntuninbagkusnangingitngitkabighaantesrisetinikaudienceiiwasanpromotesundhedspleje,sayanatigilannag-iyakankomunikasyonnakakabangontiismatalinopanghihiyangiiwanclientespangyayaripamanflyvemaskinerhiwagabidiretsahangkumikiloshiskidkiranmemoryyumaopumapasokitinalagangaffiliateiloilonalalabingprivatevarietyo-onlineprimerosmaruruminaiiritangmagpakaramibumaligtadculturasvidenskabnoonggulangpangakomartialsisidlanninyofauxanywheretignanaanhinreducedseriousailmentshallbinabalikcollectionseksenaofferagoskawayanbadingsingeralinlargefirstprogrammingnagbiyayangayonmagsasamasumusunonag-iisipnagtakatuyongnakaririmarimkwelyoinagawkinumutannananaloibinalitangkongresomagpasalamatumingitearnlihimpopcornpanigdaratingnagtungosambitpare-parehoplantarkonsentrasyonsaranggolasompunongkahoymusicfitnessmedikalmahinogaplicacionesprimerhigitestadosmaawaingdescargargusaliopportunityginatatlonapakaadvancementagricultoresnakapangasawapinag-usapantuluyannagmamadalimumuraeskwelahannakapagusapcandidatenakatayokumbinsihinmagkakailajosefaunattendedhumiwalaypinakamahabamakalipasumakbaykinalalagyannangangakonakabibingingsensiblemagingnaaksidentenakatuontungkodmagdaraostungopabilitransportnglalabavitaminpakukuluanestasyonkumampiisinuotmagtatakanatanongpalamutibinentahanpagkabuhaywinssinakophelpedmaibalikhabitnilapitanlayuankababayantagalogmurangmasseskelan